ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1643

Name

DDB2

Synonym

DDBB|UV-DDB2;damage-specific DNA binding protein 2, 48kDa;DDB2;damage-specific DNA binding protein 2, 48kDa

Definition

DDB p48 subunit|DNA damage-binding protein 2|UV-DDB 2|UV-damaged DNA-binding protein 2|damage-specific DNA-binding protein 2|xeroderma pigmentosum group E protein

Position

11p12-p11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Formation of incision complex in GG-NER;PID Reactome;500060

Pathway

p53 pathway;PANTHER;P00059

Pathway

Nucleotide excision repair;KEGG PATHWAY;hsa03420

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Dual incision reaction in GG-NER;PID Reactome;500061

Pathway

DNA Repair;Reactome;REACT:216

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Pathway

Global Genomic NER (GG-NER);PID Reactome;500058

Disease

Inherited disorders of DNA repair systems;KEGG DISEASE

Disease

Breast cancer;FunDO

Disease

Disorders of nucleotide excision repair;KEGG DISEASE;H00403

Disease

Xeroderma pigmentosum, group E, DDB-negative subtype;OMIM

Disease

Genetic disorders;KEGG DISEASE

External Links

Links to cell senescence gene database

1643

Links to epithelial mesenchymal transition gene database

1643

Links to ovarian cancer gene database

1643

Links to endometrial cancer gene database

1643

Links to iHOP

1643

Sequence Information

Nucleotide Sequence

>1643 : length: 1870
CTCCGAGACGGGTGGGGCCGGAGCTCCAAGCTGGTTTGAACAAGCCCTGGGCATGTTTGG
CGGGAAGTTGGCTTAGCTCGGCTACCTGTGGCCCCGCAGTTTTGTAGTCCCCGCCTTGTT
TCTCCCCAGAGGCCTCTCAATCCTCCCTCCATGATCTTCGCATAGAGCACAGTACCCCTT
CACACGGAGGACGCGATGGCTCCCAAGAAACGCCCAGAAACCCAGAAGACCTCCGAGATT
GTATTACGCCCCAGGAACAAGAGGAGCAGGAGTCCCCTGGAGCTGGAGCCCGAGGCCAAG
AAGCTCTGTGCGAAGGGCTCCGGTCCTAGCAGAAGATGTGACTCAGACTGCCTCTGGGTG
GGGCTGGCTGGCCCACAGATCCTGCCACCATGCCGCAGCATCGTCAGGACCCTCCACCAG
CATAAGCTGGGCAGAGCTTCCTGGCCATCTGTCCAGCAGGGGCTCCAGCAGTCCTTTTTG
CACACTCTGGATTCTTACCGGATATTACAAAAGGCTGCCCCCTTTGACAGGAGGGCTACA
TCCTTGGCGTGGCACCCAACTCACCCCAGCACCGTGGCTGTGGGTTCCAAAGGGGGAGAT
ATCATGCTCTGGAATTTTGGCATCAAGGACAAACCCACCTTCATCAAAGGGATTGGAGCT
GGAGGGAGCATCACTGGGCTGAAGTTTAACCCTCTCAATACCAACCAGTTTTACGCCTCC
TCAATGGAGGGAACAACTAGGCTGCAAGACTTTAAAGGCAACATTCTACGAGTTTTTGCC
AGCTCAGACACCATCAACATCTGGTTTTGTAGCCTGGATGTGTCTGCTAGTAGCCGAATG
GTGGTCACAGGAGACAACGTGGGGAACGTGATCCTGCTGAACATGGACGGCAAAGAGCTT
TGGAATCTCAGAATGCACAAAAAGAAAGTGACGCATGTGGCCCTGAACCCATGCTGTGAT
TGGTTCCTGGCCACAGCCTCCGTAGATCAAACAGTGAAAATTTGGGACCTGCGCCAGGTT
AGAGGGAAAGCCAGCTTCCTCTACTCGCTGCCGCACAGGCATCCTGTCAACGCAGCTTGT
TTCAGTCCCGATGGAGCCCGGCTCCTGACCACGGACCAGAAGAGCGAGATCCGAGTTTAC
TCTGCTTCCCAGTGGGACTGCCCCCTGGGCCTGATCCCGCACCCTCACCGTCACTTCCAG
CACCTCACACCCATCAAGGCAGCCTGGCATCCTCGCTACAACCTCATTGTTGTGGGCCGA
TACCCAGATCCTAATTTCAAAAGTTGTACCCCTTATGAATTGAGGACGATCGACGTGTTC
GATGGAAACTCAGGGAAGATGATGTGTCAGCTCTATGACCCAGAATCTTCTGGCATCAGT
TCGCTTAATGAATTCAATCCCATGGGGGACACGCTGGCCTCTGCAATGGGTTACCACATT
CTCATCTGGAGCCAGGAGGAAGCCAGGACACGGAAGTGAGAGACACTAAAGAAGGTGTGG
GCCAGACAAGGCCTTGGAGCCCACACATGGGATCAAGTCCTGCAAGCAGAGGTGGCGATT
TGTTAAAGGGCCAAAAGTATCCAAGGTTAGGGTTGGAGCAGGGGTGCTGGGACCTGGGGC
ACTGTGGGACTGGGACACTTTTATGTTAATGCTCTGGACTTGCCTCCAGAGACTGCTCCA
GAGTTGGTGACACAGCTGTCCCAAGGGCCCCTCTGTATCTAGCCTGGAACCAAGGTTATC
TTGGAACTAAATGACTTTTCTCCTCTCAGTGGGTGGTAGCAGAGGGATCAAGCAGTTATT
TGATTTGTGCTCACTTTTGATATGGCCAATAAAACCATACCGACTGAGAAAAAAAAAAAA
AAAAAAAAAA

Protein Sequence

>1643 : length: 427
MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGP
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK