ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1616

Name

DAXX

Synonym

BING2|DAP6|EAP1;death-domain associated protein;DAXX;death-domain associated protein

Definition

CENP-C binding protein|ETS1-associated protein 1|Fas-binding protein|death domain-associated protein 6|death-associated protein 6|fas death domain-associated protein

Position

6p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

fas signaling pathway (cd95);PID BioCarta;100167

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

stress induction of hsp regulation;PID BioCarta;100142

Pathway

regulation of transcriptional activity by pml;PID BioCarta;100067

Pathway

Amyotrophic lateral sclerosis (ALS);KEGG PATHWAY;hsa05014

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144

Pathway

HIV-1 Nef: Negative effector of Fas and TNF-alpha;PID Curated;200133

Pathway

FAS signaling pathway;PANTHER;P00020

Disease

Virus disease;FunDO

External Links

Links to cell senescence gene database

1616

Links to epithelial mesenchymal transition gene database

1616

Links to ovarian cancer gene database

1616

Links to endometrial cancer gene database

1616

Links to iHOP

1616

Sequence Information

Nucleotide Sequence

>1616 : length: 2632
ACGACAATATGGCGGCGCTTAGTTGCATGAAGGCGGAAACTCTGTGACTTCCGGTCCGTA
GTGGGGCCTGCGGTGGGAGTGGGAAGGAAGGCGGAGGGAACCATGCGAGGTTCTGAGAAT
TGCGGCGAGGGTCGCCTCGAGAGACGGTTTCTGAGCAGGAATTCTGAAATCCCCACCACT
TCCTCCCTCCGGGGGATTTGATCCCCTATGGCCACCGCTAACAGCATCATCGTGCTGGAT
GATGATGACGAAGATGAAGCAGCTGCTCAGCCAGGGCCCTCCCACCCACTCCCCAATGCG
GCCTCACCTGGGGCAGAAGCCCCTAGCTCCTCTGAGCCTCATGGGGCCAGAGGAAGCAGT
AGTTCGGGCGGCAAGAAATGCTACAAGCTGGAGAATGAGAAGCTGTTCGAAGAGTTCCTT
GAACTTTGTAAGATGCAGACAGCAGACCACCCTGAGGTGGTCCCATTCCTCTATAACCGG
CAGCAACGTGCCCACTCTCTGTTTTTGGCCTCGGCGGAGTTCTGCAACATCCTCTCTAGG
GTCCTGTCTCGGGCCCGGAGCCGGCCAGCCAAGCTCTATGTCTACATCAATGAGCTCTGC
ACTGTTCTCAAGGCCCACTCAGCCAAAAAGAAGCTGAACTTGGCCCCTGCCGCCACCACC
TCCAATGAGCCCTCTGGGAATAACCCTCCCACACACCTCTCCTTGGACCCCACAAATGCT
GAAAACACTGCCTCTCAGTCTCCAAGGACCCGTGGTTCCCGGCGGCAGATCCAGCGTTTG
GAGCAGCTGCTGGCGCTCTATGTGGCAGAGATCCGGCGGCTGCAGGAAAAGGAGTTGGAT
CTCTCAGAATTGGATGACCCAGACTCCGCATACCTGCAGGAGGCACGGTTGAAGCGTAAG
CTGATCCGCCTCTTTGGGCGACTATGTGAGCTGAAAGACTGCTCTTCACTGACCGGCCGT
GTCATAGAGCAGCGCATCCCCTACCGTGGCACCCGCTACCCAGAGGTTAACAGGCGCATT
GAGCGGCTCATCAACAAGCCAGGGCCTGATACCTTCCCTGACTATGGGGATGTGCTTCGG
GCTGTAGAGAAGGCAGCTGCCCGACACAGCCTTGGCCTCCCCCGACAGCAGCTCCAGCTC
ATGGCTCAGGATGCCTTCCGAGATGTGGGCATCAGGTTACAGGAGCGACGTCACCTCGAT
CTCATCTACAACTTTGGCTGCCACCTCACAGATGACTATAGGCCAGGCGTTGACCCTGCA
CTATCAGATCCTGTGTTGGCCCGGCGCCTTCGGGAAAACCGGAGTTTGGCCATGAGTCGG
CTGGATGAGGTCATCTCCAAATATGCAATGTTGCAAGACAAAAGTGAGGAGGGCGAGAGA
AAAAAGAGAAGAGCTCGGCTCCAAGGCACCTCTTCCCACTCTGCAGACACCCCCGAAGCC
TCCTTGGATTCTGGTGAGGGCCCTAGTGGAATGGCATCCCAGGGGTGCCCTTCTGCCTCC
AGAGCTGAGACAGATGACGAAGACGATGAGGAGAGTGATGAGGAAGAGGAGGAGGAGGAG
GAAGAAGAAGAGGAGGAGGCCACAGATTCTGAAGAGGAGGAGGATCTGGAACAGATGCAG
GAGGGTCAGGAGGATGATGAAGAGGAGGACGAAGAGGAAGAAGCAGCAGCAGGTAAAGAT
GGAGACAAGAGCCCCATGTCCTCACTACAGATCTCCAATGAAAAGAACCTGGAACCTGGC
AAACAGATCAGCAGATCTTCAGGGGAGCAGCAAAACAAAGGACGCATAGTGTCACCATCG
TTACTGTCAGAAGAACCCCTGGCCCCCTCCAGCATAGATGCTGAAAGCAATGGAGAACAG
CCTGAGGAGCTGACCCTGGAGGAAGAAAGCCCTGTGTCTCAGCTCTTTGAGCTAGAGATT
GAAGCTTTGCCCCTGGATACCCCTTCCTCTGTGGAGACGGACATTTCCTCTTCCAGGAAG
CAATCAGAGGAGCCCTTCACCACTGTCTTAGAGAATGGAGCAGGCATGGTCTCTTCTACT
TCCTTCAATGGAGGCGTCTCTCCTCACAACTGGGGAGATTCTGGTCCCCCCTGCAAAAAA
TCTCGGAAGGAGAAGAAGCAAACAGGATCAGGGCCATTAGGAAACAGCTATGTGGAAAGG
CAAAGGTCAGTGCATGAGAAGAATGGGAAAAAGATATGTACCCTGCCCAGCCCACCTTCC
CCCTTGGCTTCCTTGGCCCCAGTTGCTGATTCCTCCACGAGGGTGGACTCTCCCAGCCAT
GGCCTGGTGACCAGCTCCCTCTGCATCCCTTCTCCAGCCCGGCTGTCCCAAACCCCCCAT
TCACAGCCTCCTCGGCCTGGTACTTGCAAGACAAGTGTGGCCACACAATGCGATCCAGAA
GAGATCATCGTGCTCTCAGACTCTGATTAGCTGCCTCCCCTTCTCCCTGCCTCCAGAATG
TTCTGGGATAACATTTGGAGGAAGGTGGGAAGCAGATGACTGAGGAAGGGATGGACTAAG
CTAATCCCCTTTTGGTGGTGTTTCTTTAAAAAAAAAAAAAAGCTTAAGTTTTACACAGAA
ACATTAATAAACAATAAAGTTCTTTTCTTACTGTAAAAAAAAAAAAAAAAAA

Protein Sequence

>1616 : length: 752
MRGSENCGEGRLERRFLSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGAR
GSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNI
LSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDP
TNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARL
KRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGD
VLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGV
DPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADT
PEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLE
QMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIV
SPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISS
SRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSY
VERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQ
TPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD