ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1591

Name

CYP24A1

Synonym

CP24|CYP24|HCAI|P450-CC24;cytochrome P450, family 24, subfamily A, polypeptide 1;CYP24A1;cytochrome P450, family 24, subfamily A, polypeptide 1

Definition

1,25-@dihydroxyvitamin D3 24-hydroxylase|1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial|24-OHase|cytochrome P450 24A1|cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase)|cytochrome P450-CC24|exo-mitochondrial protein|vitamin D 24-hydroxyl

Position

20q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vitamin D metabolism and pathway;PANTHER;P04396

Pathway

Vitamin D (calciferol) metabolism;PID Reactome;500600

Pathway

Vitamins;PID Reactome;500202

Pathway

Biological oxidations;Reactome;REACT:13433

Pathway

Metabolism of lipids and lipoproteins;Reactome;REACT:22258

Pathway

Metabolism of vitamins and cofactors;Reactome;REACT:11193

Pathway

Hormone biosynthesis;Reactome;REACT:15314

Disease

Cancer;FunDO

Disease

Diabetes mellitus;FunDO

External Links

Links to cell senescence gene database

1591

Links to epithelial mesenchymal transition gene database

1591

Links to ovarian cancer gene database

1591

Links to endometrial cancer gene database

1591

Links to iHOP

1591

Sequence Information

Nucleotide Sequence

>1591 : length: 3287
GACAGGAGGAAACGCAGCGCCAGCAGCATCTCATCTACCCTCCTTGACACCTCCCCGTGG
CTCCAGCCAGACCCTAGAGGTCAGCCTTGCGGACCAACAGGAGGACTCCCAGCTTTCCCT
TTTCAAGAGGTCCCCAGACACCGGCCACCCTCTTCCAGCCCCTGCGGCCAGTGCAAGGAG
GCACCAATGCTCTGAGGCTGTCGCGTGGTGCAGCGTCGAGCATCCTCGCCGAGGTCCTTT
CTGCTGCCTGTCCCGCCTCACCCCGCTCCATCACACCAGCTGGCCCTCTTTGCTTCCTTT
TCCCAGAATCGTTAAGCCCCGACTCCCACTAGCACCTCGTACCAACCTCGCCCCACCCCA
TCCTCCTGCCTTCCCGCGCTCCGGTGTCCCCCGCTGCCATGAGCTCCCCCATCAGCAAGA
GCCGCTCGCTTGCCGCCTTCCTGCAGCAGCTGCGCAGTCCGAGGCAGCCCCCGAGACTGG
TGACATCTACGGCGTACACGTCCCCTCAGCCGCGAGAGGTGCCAGTCTGCCCGCTGACAG
CTGGTGGCGAGACTCAGAACGCGGCCGCCCTGCCGGGCCCCACCAGCTGGCCACTGCTGG
GCAGCCTGCTGCAGATTCTCTGGAAAGGGGGTCTCAAGAAACAGCACGACACCCTGGTGG
AGTACCACAAGAAGTATGGCAAGATTTTCCGCATGAAGTTGGGTTCCTTTGAGTCGGTGC
ACCTGGGCTCGCCATGCCTGCTGGAAGCGCTGTACCGCACCGAGAGCGCGTACCCGCAGC
GGCTGGAGATCAAACCGTGGAAGGCCTATCGCGACTACCGCAAAGAAGGCTACGGGCTGC
TGATCCTGGAAGGGGAAGACTGGCAGCGGGTCCGGAGTGCCTTTCAAAAGAAACTAATGA
AACCAGGGGAAGTGATGAAGCTGGACAACAAAATCAATGAGGTCTTGGCCGATTTTATGG
GCAGAATAGATGAGCTCTGTGATGAAAGAGGCCACGTTGAAGACTTGTACAGCGAACTGA
ACAAATGGTCGTTTGAAAGTATCTGCCTCGTGTTGTATGAGAAGAGATTTGGGCTTCTCC
AGAAGAATGCAGGGGATGAAGCTGTGAACTTCATCATGGCCATCAAAACAATGATGAGCA
CGTTTGGGAGGATGATGGTCACTCCAGTCGAGCTGCACAAGAGCCTCAACACCAAGGTCT
GGCAGGACCACACTCTGGCCTGGGACACCATTTTCAAATCAGTCAAAGCTTGTATCGACA
ACCGGTTAGAGAAGTATTCTCAGCAGCCTAGTGCAGATTTCCTTTGTGACATTTATCACC
AGAATCGGCTTTCAAAGAAAGAATTGTATGCTGCTGTCACAGAGCTCCAGCTGGCTGCGG
TGGAAACGACAGCAAACAGTCTAATGTGGATTCTCTACAATTTATCCCGTAATCCCCAAG
TGCAACAAAAGCTTCTTAAGGAAATTCAAAGTGTATTACCTGAGAATCAGGTGCCACGGG
CAGAAGATTTGAGGAATATGCCGTATTTAAAAGCCTGTCTGAAAGAATCTATGAGGCTTA
CGCCGAGTGTACCATTTACAACTCGGACTCTTGACAAGGCAACAGTTCTGGGTGAATATG
CTTTACCCAAAGGAACAGTGCTCATGCTAAATACCCAGGTGTTGGGATCCAGTGAAGACA
ATTTTGAAGATTCAAGTCAGTTTAGACCTGAACGTTGGCTTCAGGAGAAGGAAAAAATTA
ATCCTTTTGCGCATCTTCCATTTGGCGTTGGAAAAAGAATGTGCATTGGTCGCCGATTAG
CAGAGCTTCAACTGCATTTGGCTCTTTGTTGGATTGTCCGCAAATACGACATCCAGGCCA
CAGACAATGAGCCTGTTGAGATGCTACACTCAGGCACCCTGGTGCCCAGCCGGGAACTCC
CCATCGCGTTTTGCCAGCGATAATACGCCTCAGATGGTGGTATTTGCTAACATCATATCC
AACTCAGGGAAGCGGACTGAGTGCTGGGATCCAAGGCATTCTACAGGGTTCACTGCTGGT
TTACACTTCACCTGTGTCAGCACCATCTTCAGGTGCTTAGAATGGCCTGGGAGCCTGTTC
TGTCTTGCATCTTCCATGACATGAAAGGGAGGCTGGCACTTGTCAGTCAGGTAGAGGTTA
CAAACCGTTTCAGGCCCTGCCTACCACATTCACTGTTTGAATCTTTAATTCCCAAGAATA
AGTTTACATTTCACAATGAATGACCTACAACAGCTAAATTTTCTGGGGCTGGGAGTAATA
CTGACAATCCATTTACTGTAGCTCTGCTTAATGTACTACTTAGGAAAATGTCCCTGCTTA
ATAATGTAAGCCAAGCTAAATGATGGTTAAAGTTATCAGGCCTCCCATGAAATTGCGTTC
TTCCTGCATTGAAATAAAAACATTATTGGGAAACTAGAGAACACCTCTATTTTTAAAAGG
ACTTTAACGAAGTCAAACAACTTATAAGACTAGTGATTCACTGGGGCATTATTTTGTTAG
AGGACCTTAAAATTGTTTATTTTTTAAATGTGATTCCTTTATGGCATTAGGGTAAAGATG
AAGCAATAATTTTTAAATTGTGTATGTGCATATGAAGCACAGACATGCATGTGTGTGTGT
GTCTGTGTGTGTGTGTCCGTGTATGTGTGTGTGGGTTCTAATGGTAATTTGCCTCAGTCA
TTTTTTTAATATTTGCAGTACTTGATTTAGGATCTGTGGTGCAGGGCAATGTTTCAAAGT
TTAGTCACAGCTTAAAAACATTCAGTGTGACTTTAATATTATAAAATGATTTCCCATGCC
ATAATTTTTCTGTCTATTAAATGGGACAAGTGTAAAGCATGCAAAAGTTAGAGATCTGTT
ATATAACATTTGTTTTGTGATTTGAACTCCTAGGAAAAATATGATTTCATAAATGTAAAA
TGCACAGAAATGCATGCAATACTTATAAGACTTAAAAATTGTGTTTACAGATGGTTTATT
TGTGCATATTTTTACTACTGCTTTTCCTAAATGCATACTGTATATAATTCTGTGTATTTG
ATAAATATTTCTTCCTACATTATATTTTTAGAATATTTCAGAAATATACATTTATGTCTT
TATATTGTAATAAATATGTACATATCTAGGTATATGCTTTCTCTCTGCTGTGAAATTATT
TTTAGAATTATAAATTCACGTCTTGTCAGATTTCATCTGTATACCTTCAAATTCTCTGAA
AGTAAAAATAAAAGTTTTTAAATATTAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>1591 : length: 514
MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPG
PTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYR
TESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKIN
EVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIM
AIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSAD
FLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVL
PENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQ
VLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIV
RKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR