ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1523

Name

CUX1

Synonym

CASP|CDP|CDP/Cut|CDP1|COY1|CUTL1|CUX|Clox|Cux/CDP|GOLIM6|Nbla10317|p100|p110|p200|p75;cut-like homeobox 1;CUX1;cut-like homeobox 1

Definition

CCAAT displacement protein|cut homolog|golgi integral membrane protein 6|homeobox protein cux-1|protein CASP|putative protein product of Nbla10317

Position

7q22.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

1523

Links to epithelial mesenchymal transition gene database

1523

Links to ovarian cancer gene database

1523

Links to endometrial cancer gene database

1523

Links to iHOP

1523

Sequence Information

Nucleotide Sequence

>1523 : length: 14122
CGGTCCGAGCCGCGATCGCCGCGCGCCTGGGGGCTCCGGCGGCCCCCGGTGACCTGCGGC
GCCGGGTCCCTTCCTTGCGTCCCCTCGGGGCTTCTGCCCTCTCTGCAGGGCCCGCCATGG
AGCGCGCGGCGGGTGCGCTCGGAGATGCCTTCTCGGGCCGGGTTCTCGAAAGCAGAGCCC
CGGGGGCCCGTTGGGACCGTGGCATGCCGGGCGGTGGTCCGCGCGCGGAGTCCCCGGCGC
CGCGGGGGGACCGTGCCGGGGCTCCCCGGCCCGCGCCCGAGTCGCCGCCGTGCCCAAGGG
GCGAGTGCCTGCCTGCCACCCCCCGCCCGGAGGAGCGGCGCACCCTTAGGGTCCGCCCCG
CACGTGCCAGCTCGGCGCCCGCGGCGCCGGGACAGCCCCGGGACTCTGCCAGGTGGATGT
TGTGCGTAGCCGGAGCCAGGTTGAAGAGAGAACTCGATGCCACCGCAACGGTATTGGCGA
ACCGGCAGGATGAAAGTGAGCAGTCCAGAAAGCGGCTTATCGAACAGAGCCGGGAGTTCA
AGAAGAACACTCCAGAGGATTTGCGCAAGCAGGTAGCGCCGCTGCTGAAGAGTTTCCAAG
GAGAGATTGATGCACTGAGTAAAAGAAGCAAGGAAGCTGAAGCAGCTTTCTTGAATGTCT
ACAAAAGATTGATTGACGTCCCAGATCCCGTACCAGCTTTGGATCTCGGACAGCAACTCC
AGCTCAAAGTGCAGCGCCTGCACGATATTGAAACAGAGAACCAGAAACTTAGGGAAACTC
TGGAAGAATACAACAAGGAATTTGCTGAAGTGAAAAATCAAGAGGTTACGATAAAAGCAC
TTAAAGAGAAAATCCGAGAATATGAACAGACACTGAAGAACCAAGCCGAAACCATAGCTC
TTGAGAAGGAACAGAAGTTACAGAATGACTTTGCAGAAAAGGAGAGAAAGCTGCAGGAGA
CACAGATGTCCACCACCTCAAAGCTGGAGGAAGCTGAGCATAAGGTTCAGAGCCTACAAA
CAGCCCTGGAAAAAACTCGAACAGAATTATTTGACCTGAAAACCAAATACGATGAAGAAA
CTACTGCAAAGGCCGACGAGATTGAAATGATCATGACGGACCTTGAAAGGGCAAACCAGA
GGGCAGAGGTGGCTCAGAGAGAGGCGGAGACCTTAAGGGAACAGCTCTCATCGGCCAATC
ACTCCCTCCAGCTGGCCTCACAGATCCAGAAGGCACCAGACGTGGAGCAGGCCATAGAGG
TGCTGACCCGCTCCAGCCTAGAAGTTGAGTTGGCCGCCAAGGAGCGGGAGATCGCACAGC
TGGTGGAGGACGTGCAGAGACTCCAGGCCAGCCTCACCAAGCTGCGGGAGAATTCGGCCA
GCCAGATCTCACAGCTTGAGCAGCAGCTGAGCGCCAAAAACAGCACACTCAAACAACTGG
AAGAAAAACTCAAAGGCCAGGCTGACTATGAAGAGGTGAAGAAAGAGCTGAACATTCTGA
AGTCCATGGAGTTTGCACCGTCCGAGGGCGCTGGGACACAGGATGCGGCCAAGCCCCTGG
AGGTGCTGTTGCTGGAGAAGAACCGCTCGCTGCAGTCCGAGAACGCCGCGCTGCGCATCT
CCAACAGCGACCTGAGCGGGTCAGCCAGGAGGAAAGGGAAAGACCAGCCTGAAAGTCGGC
GCCCGGGATCTTTGCCGGCCCCCCCTCCTTCTCAGTTGCCCCGCAACCCGGGGGAGCAGG
CTTCCAATACTAATGGTACACACCAGTTCTCACCAGCGGGGTTAAGTCAAGACTTTTTCA
GCTCATCCCTGGCAAGCCCCAGCCTACCCCTGGCTTCTACAGGAAAATTTGCACTAAACT
CTCTTCTCCAGCGGCAGCTAATGCAGTCCTTCTACTCCAAGGCTATGCAGGAAGCCGGAA
GCACAAGCATGATTTTTTCAACAGGTCCATACAGCACAAACTCCATATCTTCCCAAAGTC
CATTACAACAAAGCCCAGATGTCAATGGCATGGCCCCATCCCCCAGCCAGTCAGAAAGTG
CTGGGAGCGTCTCCGAGGGCGAGGAGATGGACACTGCAGAAATCGCCCGGCAGGTCAAAG
AGCAGCTGATTAAGCACAATATCGGACAACGTATTTTCGGACATTATGTGTTGGGACTGT
CTCAAGGGTCCGTGAGCGAGATTCTGGCCCGGCCCAAGCCATGGAATAAACTGACTGTTC
GTGGCAAGGAGCCATTTCACAAGATGAAACAGTTCCTCTCCGATGAGCAGAACATCCTGG
CCCTCCGTAGCATCCAAGGCAGACAAAGAGAGAATCCAGGCCAGAGCCTGAACAGACTAT
TTCAGGAAGTACCGAAACGAAGAAATGGGTCTGAAGGTAACATCACCACCCGGATCCGAG
CCTCGGAGACTGGCTCTGATGAAGCCATCAAGTCCATCCTAGAGCAAGCCAAGAGGGAGC
TCCAAGTGCAGAAAACTGAGCCGGCCCAGCCTTCCTCCGCATCCGGCAGCGGGAACTCTG
ATGACGCCATCCGCTCCATCCTGCAGCAAGCCCGCCGGGAGATGGAGGCCCAGCAGGCTG
CCCTCGACCCTGCCTTAAAGCAGGCACCACTGTCCCAGAGTGACATCACCATCCTCACCC
CCAAGCTTCTGTCCACCTCGCCCATGCCCACCGTGTCCAGCTACCCACCTCTCGCCATCT
CCCTGAAGAAGCCCTCCGCAGCTCCTGAGGCCGGTGCCTCTGCTCTGCCGAACCCCCCGG
CCCTCAAAAAGGAGGCCCAGGACGCCCCCGGGCTGGACCCCCAGGGAGCAGCCGATTGTG
CACAAGGGGTCCTGAGACAGGTGAAAAATGAGGTGGGCCGCAGCGGTGCCTGGAAGGACC
ACTGGTGGAGCGCGGTGCAGCCGGAGAGAAGAAATGCCGCCTCCTCCGAGGAGGCCAAGG
CCGAAGAAACGGGCGGCGGGAAAGAGAAGGGCAGCGGTGGCAGCGGAGGTGGCAGCCAGC
CTCGGGCCGAGCGCAGTCAGCTCCAGGGACCCTCGTCGTCAGAGTACTGGAAGGAGTGGC
CCAGCGCTGAGTCCCCATACTCCCAGAGCTCAGAGCTGAGTCTGACCGGGGCCAGCCGCA
GCGAGACACCACAGAACAGCCCCCTGCCATCCTCCCCGATCGTGCCCATGTCCAAGCCCA
CCAAGCCCTCGGTCCCCCCGCTGACCCCCGAGCAGTACGAGGTCTACATGTACCAGGAGG
TGGACACCATCGAGCTCACCCGGCAGGTTAAGGAAAAGCTGGCCAAGAACGGCATCTGCC
AGAGAATCTTCGGGGAGAAGGTGCTGGGCCTGTCCCAGGGCAGCGTCAGCGACATGCTGT
CCCGACCGAAGCCATGGAGCAAGCTGACGCAGAAAGGCCGAGAACCCTTCATCCGGATGC
AGCTCTGGCTGAACGGCGAGCTAGGCCAGGGTGTTCTACCCGTCCAGGGCCAGCAGCAAG
GGCCAGTCCTCCACTCCGTGACATCGCTCCAGGACCCGCTGCAGCAGGGCTGTGTGAGCT
CAGAAAGCACTCCAAAGACCTCCGCCAGCTGCAGCCCTGCCCCTGAGTCCCCGATGAGTT
CCAGTGAGTCGGTGAAGAGCCTGACCGAGCTGGTCCAGCAGCCCTGTCCCCCCATCGAGG
CGAGCAAGGACAGCAAGCCACCAGAGCCCAGTGACCCGCCAGCATCCGACTCCCAGCCCA
CAACCCCGCTGCCTCTCTCCGGACACTCGGCCCTCAGCATCCAAGAATTAGTAGCCATGT
CCCCGGAGCTGGACACCTACGGCATAACCAAGCGGGTGAAGGAGGTGCTGACGGACAACA
ACCTCGGCCAGCGCTTATTTGGGGAGACCATCTTAGGGCTCACCCAAGGCTCTGTCTCTG
ACCTCCTTGCCCGCCCCAAACCCTGGCATAAGCTCAGTCTGAAAGGACGAGAGCCCTTCG
TCCGGATGCAGCTGTGGCTGAACGACCCCAACAATGTGGAGAAGCTGATGGACATGAAAC
GGATGGAGAAGAAAGCCTACATGAAGCGGCGGCACAGCTCAGTCAGTGACAGCCAGCCCT
GCGAACCGCCCTCTGTCGGCACCGAGTACAGCCAGGGCGCCAGCCCCCAGCCCCAGCACC
AGCTGAAGAAACCCCGGGTGGTGCTGGCTCCGGAGGAGAAGGAGGCGCTGAAACGAGCGT
ATCAGCAAAAGCCATACCCGTCACCAAAAACCATCGAAGACCTCGCCACCCAGCTCAACC
TGAAAACCAGCACCGTCATCAACTGGTTCCACAACTACAGGTCTCGGATCCGCAGAGAAC
TGTTCATTGAGGAAATTCAGGCCGGGAGTCAGGGCCAGGCGGGCGCCAGCGACTCACCCT
CGGCCCGCAGCGGCCGGGCGGCGCCCAGCTCGGAGGGCGACAGCTGCGACGGCGTGGAGG
CCACTGAGGGCCCAGGCAGCGCCGACACCGAGGAGCCCAAGTCTCAGGGAGAGGCCGAGC
GGGAGGAGGTGCCGCGGCCGGCGGAGCAGACGGAGCCGCCGCCCTCGGGGACCCCGGGCC
CGGACGACGCCCGCGACGACGACCACGAGGGAGGCCCCGTGGAAGGCCCGGGGCCCCTGC
CCAGCCCCGCCTCCGCGACCGCCACCGCCGCGCCCGCGGCCCCCGAGGACGCCGCTACCT
CAGCCGCCGCCGCGCCGGGGGAGGGCCCCGCGGCCCCGAGCTCCGCGCCGCCGCCCAGCA
ACAGCAGCAGCAGCAGCGCCCCCCGCAGGCCCAGCTCGCTGCAGAGCCTTTTCGGCCTCC
CCGAGGCCGCGGGCGCCCGGGACTCGCGCGACAACCCCCTGCGCAAGAAGAAGGCCGCGA
ACTTGAACAGCATCATCCACCGCCTGGAGAAGGCCGCCAGCCGGGAGGAACCTATCGAAT
GGGAGTTCTGAGGGGCCGCGGCCCTGGGGCGGGCAGCCAGGCTGGGCCGCAAGGGCCTGG
ACGGGGTCGGACGGGGCAGGCGCTGCGGACACCGTGGCCTGGGCTTGGCCCGCGGCCTGC
ACCGACCCCGGGCCGGACCTGAGCCCGCAGCCCAGACCCCCTCCACGGTCCGCGGCCTGC
ACCGACCCGAGGCCCAGATCCAAGGCCGCGGCCCAGACCCACTCTGCGGCCCGGGCCGAC
CCTGCGGCCTCCACCAACCCCGCGGCCCAGACCCAGCCCGCGGCCTGGACCCCTGGACCG
CTTTGCGCACTTACCGCCCTGCGGGCCACAGGGCAAAATCGCCATAGGCCAAGGTGCATA
TAGAAAACAAAGGAGCATTAAGCCCAATCTATGTCGTGTTTTCAAGGAAGAAAACGGAAA
TGTGTGGTCGAGCTTTTTTGTACCCTGAAGTGTTTTTTTTATTGCCCTAAGTGATTTCCA
CAGGTTCTGGAATAACTCTTACAGCTTTGCCTTGTGTCCTCCTGTTCCGTGTGGGCTTTA
AAAGAAAAAAAATCAAACCCACATATTAAAAGGGGGCTTTTTATCTGCCATCTAATGGCT
TCAGAGCGATAATACACTATTATCTTCTTAAACCAGGAAAAAATAAAAGGGGGGGTGGGA
TTTTTCAGAAAAATTAAAAAAGAAAGTTTTTGTAGCTGTTCAGTTGCCACTAAGAGATTG
CACAGTCAAAACGACTCTAAACACACTAGTTTGGATTCCTAAATATTTTCAAGAAAAGAA
TCTTCTCGTTTGAAACTTTGAATTAAAATAAAACACATTTACTCCACATATTTTTTAACA
AAAAGAAAACGTCACATCAGGAAACTCTGATTTTGTGGTAGCTGACATAGTGTTTTCTTG
TACGTGAATAGAATCCTGACATGTAGTGCACATTGATGTATAGCTTTAACTGACCCTGGG
TTTTGCAGACCAGGGTTTGTTTAATACACTCCATTCTAGGCCAAATCAGGACAAAAAAAA
GAAAAAAAAAGAAAAAAAAAAAAGAAAAGATCCGAATCTAGGTATTTTATAATCTGCTTT
TTAACCTCTAACCGCAGAGCACGCTGATCAGACCTCATATCTTGGAGGTTTAGGAGACAA
GTTAGAACTGTAGCATGTACCTGTTAATTTTGTTTAATTTATGGTGTCTCAATCTGTCTG
TGCGTCTGCACGTGTGCAAGCATTGAAAGAAAGGAGAGAGTAGTCCGGGCGAGCACAGCA
GGCAGTTCCAGGGCCAGACGGGCCCATCCCCAAGTAGATAGCAGTCTACGGATCTCTCTC
TGGCACAGAAGGCACCTCACCTCACACCACTCTCCTGGATACCTGATGAACTGAGCCCTC
CCAGGGGAAGACACTCCCCAGGCCTGGGCAGGGCTTACACGCGCACTCTCTCTCTTCTTT
CCCTTTTTCTTCCCACCGCAAGCACTGATGACCCTGTTGAACTCGTGGGAAACTTCCTTT
CTCTGCAGGAGAGAGAACGTGGCATTCTGGGCTCCCCACTCCCATCCCTGTAGAAATGGC
CCAAACTCACACCAAAACGTGGATGCTCTTCAACTTCCAAACCTACCATTTGCCCTTCTT
TCATTTCGCCTCTTAGTTCTTTTTATGCACAGTTTTAGGGCAGTCTAAGTACAAACTGAA
AGTCTAACTTGTCTCTGATTCCTCCCTTGTCTATGTGTATATGCGTGAGAATAGAGGCGG
GTGAGAGTGTGCGTGCGTGTGCGTGTGTGCAATTTTATACGTCTGTGTATTTTCTTAAGT
ACCTGTGCACACGTAGAGTGCATTACTGCCACCTTTTTCAATAAGCTGTTTTATCAGTTA
CGGCTTCTACAAGTTTGCTAATTTAGACTTCTTTATTGCCATATCTTTAAACTAACAATA
GATGATTTCGGTATATATATATATTTTTTTTTGCTTATTTATAGGTGCTGTATTTTATTA
TCTGATTGTTAGGAAGGGATGAAAGGGGCAAATATTCTTTAGAGGGATAGACTGCCGGCA
GTATTGGGTATAATTTACAAGATGTAGTTGTCATACTGTATATTACTGATTGAAAACTTT
TTGACCGTATTGTGTATCATTGAAACCTTTGTCTTAGGTCAACATCTTTGGATGACATTT
TAATGGTGCATTCATTATTTCTTAAGTTTAATTAATATTACTTTTTTTTTTATTTGGGGG
GTGGGAGGGAGTTATAATTTTAAAGGTATGCTCTGGCTGTTCCACCTCCGTGTGCTTGTT
AATTAACTTGTAGGACTTTGACTGTAAGATGTGAAACCACGTTTCTTGCATGATGTTTTA
GAGATTATTTCATTTACAGTCTTTTAACCTGCAGCTGCAGCACTTAGTTCACGTTTTCAC
AAATTTCAAGAGTCACTACACTAAAGACAATGCCTTTTCATGAATAAGAAGTTTTCAGAA
GGCTCTAGGGGGCTGGGAGGCAGGCTGTTCGTTTGTCTTTTGTTGGGGGTATCATTTCTG
AACTTGAAATCCAGTTCAGGGAGAAGAGAATTCAAAATTAGAGGAGCTTAAGGGGACACG
GGTCAACATCTAGCTCGATTCAGGTGCATTGAGAAGAGTGAGTTCACATCGGTGACCCTT
AGGACAGTGAGTGGCAGAGCCCTGACGACTGTGGTGTCCTCTCCACAAAACCCTCAAGGG
ACTTTTGTCATCATGTGTGATGAATCTTTAAATATCGTCTAATTTTCATAAGAATGAAAA
GAAGTTAACAGGAAATAGTAGGCTAGGGTTTAGTTTTAAAGGCATGACTGTTATTTACAA
AGGTGTTAAATCTGAGGAAATTGACAAATACAGATTTGTCCATTCTAGTGGCCAAACAGT
AACAGTCTAAAATGCAGTCATTTTGACCCTCCCAAGCAATTTAGTCATATGTGTTGTTTT
CTCTTTTCTGTTTTTACTTCTTAGATTTTTAACTAGGTTACTGTTGGTTCCCATTCTGTC
TTTTTTGCCAGACTTACATCTGGTGCCAGATACAATCAGTTGGTTAAATTTTGCTTGCAG
TTCTGTGTATTTTTTTTCCTCTATTATTTATTTTTTTAAAAAAAATAGAGATCCTAACCT
TAGATCTTTGATGTGAAGCTAGCACTGTCTGTAATACTTCTAAGAGCTGCCACTAAAATA
ATACAGCAATCCGTGGCCAGGGGAGCACCCCCTCCTGGTTGGGCCCCTCAGTTGGAGTCT
AAGGGTTAATCTCTCATCTTGCTAAGCAGTATTCAAGTGCCTTGAACAGTGTCCCCTCGG
CATGGCTCCCCTTCAGCAGGCTGGCATTCCAAGCAGTGGCCCCCGCAGGCAGCCGACCCC
CTTCCTCTTCACGCTCTATGAGTTTAAAAAGCTGATTTGTACCTCTCCCCTGGGGGAAAC
GGTTCCATATAAAACACTAACACTTAATTACAAGCTCCATTATGCCATTTTAAATGGCTT
CTTTTTGTTAATTGGAGGCATTGTTCATAACTTAAGGCTTTTGCCATTAACTTAGCTGGC
TAAGCAGAGGCTCGGGGTAAAATCAGTGTTTGCATTTAGCCTCTTGACCCGGAGTTCCGG
CCCAAGCTCCCTTGTGATAGCCGAGATGGCAGGTGTGTGAGTTCTGTCCTAGACCTGTGC
CCAACTCACTTCCACCCCAGAGGAGTCTTCTGTCCTCCTCCCCAACCCCCGAGCTCCCTG
GTAACCTCCTCTTGAACTTCTGTATCAGTGAAGACATCTGTGGTTTCTGCTCACCAGACC
TCTCTTTAGAAAGGGTTATCAGAGCCATGGAGCTTAGCTCAATTGGATTCTTCTAGACGA
TCTTAGGAGGCATCTTGGCATGAGGCAGCTTCTAAGCGTCTCCTGGGACAGGATTGGGGT
GACAGCCCAGGGATGCATGCATGGGAGAACTCTCTGAGAAATGCCAGGATCGTGGCTCAC
AGGGACCCACCATCAAAACCTGCTACTTTGTGCAAGTAATTGAGGCAAAAGATACCAGTC
GACAGCCTCCCTGGGGTAGATCCCTTGTACCTCCAAAGTACAAATACCTCCCTGCTCAGT
TTCCTTCCTGTCGCCATCTTTGTTTTCTTCCCATTGAAAAACCATCCTGTCTGATGTGGA
CGTTCAGGTCTGCTGGTTGGCGGTCCGGGCCCAGAGTGCAGCAGAGCTCTGGGTTAAATA
TTCCTTTCTGGCCACCGCCCAAGCCCAGGTGGCCAGCTCTCATACCCCATCTCCCTCCTT
GGCCAGGGCCAGCATCAGGCGTGCAGCTCATGACCAGTTTACACAGGCTGCAAAGAGATC
GCTGTGGGCCTCGGCTGACTACTTTAAGATTATGCCACAGCCAGGCCCTAAAAAGAGAGG
GGAACAGGAGTCCCCAGGTGAGCTCTCTGACGGGCAGGTGCCTTCCCGACTAAGGTTGGA
CTGGATGACTTTGTTCCTCCTGCATGCATGTCCTTTGATGCAAGGGTGATCAATGAACTC
TGTTGACATTCTATGCAATGTTTTTCATTCCTCTGATTTTAGCAAAGCAAATCTTACTGA
AAAATAGCAGAGCCAGGGGAACAGACGCATGTCCTTCTGGGAGTCACACAAAAGCAGAGA
GATTTTGAACTGAGGGGCGACAGCCTTTGCCTTAAATGCAGTATGACAGGCGCTTCTTGG
CAGACCAGTAAAAACAAAAGCCCATAGACCTTACTCATCCCAAGGCCGACAAGCCAGCTG
TACAGGGCGAGATGTAGCAACACGGGGCATGAGCGGTGGGCGTGCTGGGCTATTTGCTGT
GGTACTTTAGGCTGGAGGTTTGGCTCCTGTGCTGCCGGTGGGGGGCCCTGTCCCTCCCCA
GATGTCCTCCCTCTTCTTCACACTCCTCATTGTCCCTTCTACCTCACTAACCTGTCTTCT
CCATCTGATGTCACCCAGAACCACACCCCACAGAACTGTGAGGCACGTGGGCTGGAGAGA
GCAGAAAAGCTGCCAGCGCAGCAGACACGAACATCCCTCTGCCTGGTGGGCCGGCTTTGT
GTGTCTCTCCTTTTGTGAGCGCAACACGGACAAACAGCTGTGCTCTGCAAGGCACACGGA
TGTTTCCCTTCCACCTGTTCCCAAAGCTCCAGCAGCTGTTTCTTTTGCAGGCAGGGCGTG
GTCTCGGGGCTCCGAGGGTCTTGTCTTTGGTCCGCCTTCCTTTCTGTCCAGTCCTGCTCA
GCTGTTAAGATCCATCATGGCCATTATCCTTGTCCCGGACTGCCCCAAAGTTCCCAGCTG
GCTTTGGGGAACACTGTAGCTCTTGGGTGTCTCTTGTCTCTGGCATGGTTTTAGCGTCAC
TGCGAACACTCCTTTGCAAACATCAAACATCTCAAAGACGGAAAAGGATAGATGGCTTCC
TCCAGCCTACACGCCCCGTCCACAGTGGCATCACCCTCTTATCCCAAAAGAATATGCCAG
TTCCCATCCAGCACCGAAGAAAATCAGCTCCTGGGGCTGGTGGTTGGAGGTGGGTCTGTC
CACTGTGGGGGCCAAAGTGTTCCCCTGCTGGAGACAGTTTGCAAGTAAGAACCTAAGGAT
GGGGACAGCATCCTGTGCTTGGGCATTGACCAGCCAAAGCTCACATTTAGAAAGCCCTCA
GTGCTTCTGTGGTTTCACCTGGGCATCGACGACATTAGGGAAGCCTTTGTGACCACAAGG
GCAGGGCTTGTGCCCTGAGTGGCGAGGTGGTGACCTGAGGCCAGTGTGATGTGGTTGGAT
CTCAGCGTGTACTGAATGCCAGTCTGGCCGGCACACTCGAACGCTAAGAGAATGGTCCAA
TTTGATGATCTTATTTCTATTTCGATCAGGTTTTGACTTTTTGTAGATGAAAACTACCAG
GGAAAAGGGGAAGCAGGTACCCAATAAAGTTTAGAAAGATCCAGTCTGTGAAACCCTTAG
AGATGGGCTGAAAGTTAAGTCCACCAACCCTTGGGCTTAATCAGGACGGAAGAGGAGGGG
GTGTGGGGGGCAGAGCGTAAAACAAGCCCCAGCCCTACTCCCGGCCCCCCAGCCCAGTCT
TCCCAATCCCAGAGGCCCCGGCGGCCTGTGCTCCTCACCACCCTGGTCAGGGGAATAGAA
GGAAATGCAATTTCCGCCTGTCTGCCCGACTTCCAAAAACTGCCTCCTCCTGCCCAGGCC
TCTCCCACCACCACCTTCCCTCCAAAGATAACCGTGTCCATGCCATCCGTGGCATCATCT
CGAGTTTTCATTTTTGGATGAAGTGACATTTAGCTTTAACAAGACATTTCCAAAGCGCCT
AGTCTCCTCCAAAATGCTAACTTTAAAAGTTGGGCATTGTAGGCGAAAAATCCCAAAAAA
AAAAAAAGACAAAAAAAAAAGGCTGGCGAGAGAAAGACATTTGGCTATGCATAAATGTGC
ACTTCCCCCATGCCCCCGTTCTTAAACTCTTAAGATGCCTTTGAGTTGCTTTTCATGAAT
CCTTTTAGTTTACCCGATAATGTTAAGAAAGCATTAGTCTACGTTACTGTAATTTCTGTA
GTGTTTACGCTTTAATTTCTACCACAAAATATGCTATATGCTATGTATCAAGCTTTCTGT
AATCAGAAAGAAAAGGTGCCTTATATCCCAATGTCACGGCTACATCCCTATGGAAATTAA
TCAGAAGCACAGTGTGTACGGAAGCATTGGGACTTCTGCTGGTGAAACAAGAGACCATTC
AGCAAGACACATTGAAGTGGCACGGAGCTGCTTTTGTTTTATAATTCTTTTTTCCCCCCT
TTTCCTTCTTCTTTTTTATTATTTTATTATTTTTTTTGTACTTTGCTTTAAACGGAAAGC
ACTTAAATAGATGACTATGTGTAAAAGCTCTGTGCAATTGAAATCATTTTTCTTCATTTT
AAAAAAATAACGTATTGCACACCAAATGAACTCAAAGTAAGCTTTAGACCAGGACGATTC
AGGTTATGAATGAGTTTGTTCACTGTAGTTCCGTTTGTTCATGAACCGAAGGGAAAACAG
GCCTCCCCGACTCCCTCCAGTCTCCCAGCCTGCCTCTTGGTGACCACTGTGCTGGGCGTG
CAGGGCCCGCGGGCTCTGGCCGGAGCCGCTGGCCTGACGAGGCAGGATAGGGAGTATCCG
TGATTCAGAAGCTGAGACCCTTCCCCAGTGTCTGAGGCCACAGCCATCCCTTCCAGCACT
TAATCTTGTCTTGTTGAAATGGACTGACTGCTACTGACCTGCCGGCGTGCGTGAGGGTGA
TTATAAAAGGATGTTTCCTTGAGAAAAAAAAAATTATTTCTATCCTCTTCTATTTATTAT
TAGGTTAATCATTTAAGTACTTATCAGGAGTGTATTGTTATTTTGTGTTTTGTTGTCATA
AATGCTTTTTGCTGTCACTCTAGTGGTTACTATCCTCTGCCTTCCTCTCCTCCCCTACTC
CCCCAGAGAACCAAGGCGTCTGGGGGATTGACTGGGGGGCAGAGGGGGTTTCCCCAGCAA
AATCAAACACCTGTCTCCAGAGTAGCCACTCAAAAACTGGTGGTCTCTATGTGTCTAACT
TTTTAAATGAGAGTGTTTATGAACAAAAAAATTTACCAACGTGTGAGGGAGTTGCTGAGT
TGAAGAATGCTCGCTTGAGGAGCTTCAGAGGAATCTTAGCAAAGCCAAGTTCAGTTCCCC
AAAGCCTCCTAGAGCCTCTGGTAAGACTTCTGGGTTCATGAAGTTTCGGCGAGCCGTGGT
CAGAGAGGGCGCGGTGGCCTGGCCAAGACTTTACCTCCAAGCGAGAGAGTGATTTCTTGC
AAGGCCCGCATGGGTTGATACGTTTTGGTTGGTTTTTTGTTGTTGTTTTTCTTGCGTACA
AAGTTGGTCAAAACCATCTTTCAAAGCAACAGTGTTTTGTAGTACCAGGCTGTGGCTTGA
GGGCTCACCTAGGAGATCATAGGCAGAGGGCCCCTTTCCCCTATAGGTGGTTCAACGTGG
AGGAAGGTTGGGTGTGGAGATTGCTTGCTGTGGCCCCAAGCTCAGCCAGCAGGACACCCA
GTTGTTGCCAATCAGGTGTGAAGGTGAGGCGCCCTGCCTTGATCCCATGGGCCCAGCAGA
AGGAAACTTACCCCAGGCCAAGGCAAGGGCCCTGCTCACCCCAAGGTAGGCTGGGAAGAG
CATCTCTTTCCATATCATCACCTCCCCTTCTCCAAGATTGCCGGGGGCCCTGATTTTGTT
CTCTCTTTGAAAGAAACCCTCCACCGAAACAATGGTCCCCATCTCCCCAGAAGCCTTTTT
TTTTTTCATTTTTCTCTAATTAGTCTATGCATTTCTCTCTCTCAAACCATCTTCTGCCTC
TTCCCTTGAGAAAACGGGCATCTCACGTACCCCCATCTGAGACCTCTTGGAAAAAAAAAA
TCCCGTGTATTCTGGAGATGTGAGAATTCACCCAAAATTCTTAAAACATTGGAGAATAGC
TTGTTATAAAATAAAAGTGGGGGTAAAAAGAAGGTGGTTTTCCCCACATCCCTTTGCATT
GAATAAGAGACCTAGTTCTTTGCGTTTGTGCAATAACTCTTTGCTGCTTGCCTTGAGAGC
GGGTAGCACCACGCTCCTGTCCAGACTACTAACAGCACAAGACGCACTCACAGGGTGGCG
GAATCTTCCGGAAAACTCTCTATAAGCTCAGCTCCCCCCACCCCACCCCCACTCTAGCGT
TTTGTCACGTCTTACATTTTAGCAGTATTTTATATTTTCTGTAACGCACCAAGTCTTAGA
TCTTTCTAGAGCTTGTTTGTTCATCCTCACAATCACAGATTTTTTTCTCCAATCCTCACA
GAGACCCAATTGACCAAAAAAGAAAAAAGGAAAAAAAAAAAGTCGTCTTTTTTTTTTTTT
TTTGTACAAATCGCTTTGAGATGCCTCTGGTGTGTTGCTGTGTGACATCTCTCTGGTAAC
ATTTTATTTCTTGCTATTTGTTTTTCTACATTAAGAGTCAAAGTTGACCTGGCTGGCGTG
GGGGTGGGGGAGGCACCCGTCGGCCCCTTGGTGTTGTCCCTCTGTCTTTGGTTAGCCATA
CGATGTTTGTTCTCAGCACTGTACAACGGTCCCTATATAATACGGAGAAGCAATATCACT
GTATGAGACTCACACCATGTATTATTATTCACTAGCACCCTAGGTGTGATAATTGAAGTA
AATATCTTTTATACAAACACAA

Protein Sequence

>1523 : length: 1604
MERAAGALGDAFSGRVLESRAPGARWDRGMPGGGPRAESPAPRGDRAGAPRPAPESPPCP
RGECLPATPRPEERRTLRVRPARASSAPAAPGQPRDSARWMLCVAGARLKRELDATATVL
ANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKSFQGEIDALSKRSKEAEAAFLN
VYKRLIDVPDPVPALDLGQQLQLKVQRLHDIETENQKLRETLEEYNKEFAEVKNQEVTIK
ALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSL
QTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLSSA
NHSLQLASQIQKAPDVEQAIEVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLRENS
ASQISQLEQQLSAKNSTLKQLEEKLKGQADYEEVKKELNILKSMEFAPSEGAGTQDAAKP
LEVLLLEKNRSLQSENAALRISNSDLSGSARRKGKDQPESRRPGSLPAPPPSQLPRNPGE
QASNTNGTHQFSPAGLSQDFFSSSLASPSLPLASTGKFALNSLLQRQLMQSFYSKAMQEA
GSTSMIFSTGPYSTNSISSQSPLQQSPDVNGMAPSPSQSESAGSVSEGEEMDTAEIARQV
KEQLIKHNIGQRIFGHYVLGLSQGSVSEILARPKPWNKLTVRGKEPFHKMKQFLSDEQNI
LALRSIQGRQRENPGQSLNRLFQEVPKRRNGSEGNITTRIRASETGSDEAIKSILEQAKR
ELQVQKTEPAQPSSASGSGNSDDAIRSILQQARREMEAQQAALDPALKQAPLSQSDITIL
TPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAAD
CAQGVLRQVKNEVGRSGAWKDHWWSAVQPERRNAASSEEAKAEETGGGKEKGSGGSGGGS
QPRAERSQLQGPSSSEYWKEWPSAESPYSQSSELSLTGASRSETPQNSPLPSSPIVPMSK
PTKPSVPPLTPEQYEVYMYQEVDTIELTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSDM
LSRPKPWSKLTQKGREPFIRMQLWLNGELGQGVLPVQGQQQGPVLHSVTSLQDPLQQGCV
SSESTPKTSASCSPAPESPMSSSESVKSLTELVQQPCPPIEASKDSKPPEPSDPPASDSQ
PTTPLPLSGHSALSIQELVAMSPELDTYGITKRVKEVLTDNNLGQRLFGETILGLTQGSV
SDLLARPKPWHKLSLKGREPFVRMQLWLNDPNNVEKLMDMKRMEKKAYMKRRHSSVSDSQ
PCEPPSVGTEYSQGASPQPQHQLKKPRVVLAPEEKEALKRAYQQKPYPSPKTIEDLATQL
NLKTSTVINWFHNYRSRIRRELFIEEIQAGSQGQAGASDSPSARSGRAAPSSEGDSCDGV
EATEGPGSADTEEPKSQGEAEREEVPRPAEQTEPPPSGTPGPDDARDDDHEGGPVEGPGP
LPSPASATATAAPAAPEDAATSAAAAPGEGPAAPSSAPPPSNSSSSSAPRRPSSLQSLFG
LPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF