ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1522

Name

CTSZ

Synonym

CTSX;cathepsin Z;CTSZ;cathepsin Z

Definition

carboxypeptidase LB|cathepsin B2|cathepsin IV|cathepsin P|cathepsin X|cathepsin Y|cathepsin Z1|cysteine-type carboxypeptidase|lysosomal carboxypeptidase B|preprocathepsin P

Position

20q13.32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Membrane Trafficking;Reactome;REACT:11123

Pathway

Lysosome;KEGG PATHWAY;hsa04142

Disease

Tuberculosis;FunDO

External Links

Links to cell senescence gene database

1522

Links to epithelial mesenchymal transition gene database

1522

Links to ovarian cancer gene database

1522

Links to endometrial cancer gene database

1522

Links to iHOP

1522

Sequence Information

Nucleotide Sequence

>1522 : length: 1517
AAAGTGCGGGGTCGGCCGGGTGCTGGGCCGAGGCCGAGGCCGGGGCGGGATCCAGAGCGG
GAGCCGGCGCGGGATCTGGGACTCGGAGCGGGATCCGGAGCGGGACCCAGGAGCCGGCGC
GGGGCCATGGCGAGGCGCGGGCCAGGGTGGCGGCCGCTTCTGCTGCTCGTGCTGCTGGCG
GGCGCGGCGCAGGGCGGCCTCTACTTCCGCCGGGGACAGACCTGCTACCGGCCTCTGCGG
GGGGACGGGCTGGCTCCGCTGGGGCGCAGCACATACCCCCGGCCTCATGAGTACCTGTCC
CCAGCGGATCTGCCCAAGAGCTGGGACTGGCGCAATGTGGATGGTGTCAACTATGCCAGC
ATCACCCGGAACCAGCACATCCCCCAATACTGCGGCTCCTGCTGGGCCCACGCCAGCACC
AGCGCTATGGCGGATCGGATCAACATCAAGAGGAAGGGAGCGTGGCCCTCCACCCTCCTG
TCCGTGCAGAACGTCATCGACTGCGGTAACGCTGGCTCCTGTGAAGGGGGTAATGACCTG
TCCGTGTGGGACTACGCCCACCAGCACGGCATCCCTGACGAGACCTGCAACAACTACCAG
GCCAAGGACCAGGAGTGTGACAAGTTTAACCAATGTGGGACATGCAATGAATTCAAAGAG
TGCCACGCCATCCGGAACTACACCCTCTGGAGGGTGGGAGACTACGGCTCCCTCTCTGGG
AGGGAGAAGATGATGGCAGAAATCTACGCAAATGGTCCCATCAGCTGTGGAATAATGGCA
ACAGAAAGACTGGCTAACTACACCGGAGGCATCTATGCCGAATACCAGGACACCACATAT
ATAAACCATGTCGTTTCTGTGGCTGGGTGGGGCATCAGTGATGGGACTGAGTACTGGATT
GTCCGGAATTCATGGGGTGAACCATGGGGCGAGAGAGGCTGGCTGAGGATCGTGACCAGC
ACCTATAAGGATGGGAAGGGCGCCAGATACAACCTTGCCATCGAGGAGCACTGTACATTT
GGGGACCCCATCGTTTAAGGCCATGTCACTAGAAGCGCAGTTTAAGAAAAGGCATGGTGA
CCCATGACCAGAGGGGATCCTATGGTTATGTGTGCCAGGCTGGCTGGCAGGAACTGGGGT
GGCTATCAATATTGGATGGCGAGGACAGCGTGGCACTGGCTGCGAGTGTTCCTGAGAGTT
GAAAGTGGGATGACTTATGACACTTGCACAGCATGGCTCTGCCTCACAATGATGCAGTCA
GCCACCTGGTGAAGAAGTGACCTGCGACACAGGAAACGATGGGACCTCAGTCTTCTTCAG
CAGAGGACTTGATATTTTGTATTTGGCAACTGTGGGCAATAATATGGCATTTAAGAGGTG
AAAGAGTTCAGACTTATCACCATTCTTATGTCACTTTAGAATCAAGGGTGGGGGAGGGAG
GGAGGGAGTTGGCAGTTTCAAATCGCCCAAGTGATGAATAAAGTATCTGGCTCTGCACGA
AAAAAAAAAAAAAAAAA

Protein Sequence

>1522 : length: 303
MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPA
DLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV
QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECH
AIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN
HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGD
PIV