ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

151871

Name

DPPA2

Synonym

CT100|ECAT15-2|PESCRG1;developmental pluripotency associated 2;DPPA2;developmental pluripotency associated 2

Definition

cancer/testis antigen 100|developmental pluripotency-associated protein 2|embryonic stem cell (ESC) associated transcript 15-2|pluripotent embryonic stem cell-related gene 1 protein

Position

3q13.13

Gene Type

protein-coding

External Links

Links to cell senescence gene database

151871

Links to epithelial mesenchymal transition gene database

151871

Links to ovarian cancer gene database

151871

Links to endometrial cancer gene database

151871

Links to iHOP

151871

Sequence Information

Nucleotide Sequence

>151871 : length: 1393
AGCCCTTTGTTTATGGCCTGATCTAGCTAAGGCTTCTAGACTTCAGGAGCTTAAGAATCG
TCCGGAGGGCTGGGCGTGGCGGTGCAGGCCTGTAGTCCCACCCACTCCGAAGGCTGCGGA
GGGAGGATCAACTTGAGTCTGGGAACTCAGCCAGGAATTCAAGACCAGCCTGGGCAACAC
AGTGAGGCCCCCTACCCACATCCTCTCCGTCCCCGCAATCTCCTTCCATCCCAGGGTGTT
GCTGAAAATGTCAGATGCAAATTTGGATAGCAGCAAGAAGAATTTCTTGGAGGGGGAAGT
AGATGATGAGGAAAGTGTGATTTTGACACTGGTGCCAGTTAAAGATGACGCAAATATGGA
ACAAATGGAACCAAGCGTTTCTTCAACTTCTGATGTCAAACTGGAGAAGCCTAAGAAATA
CAATCCAGGTCATCTACTTCAAACAAATGAGCAATTTACAGCTCCACAAAAAGCTAGATG
CAAAATACCAGCCCTTCCCTTGCCGACCATTTTGCCTCCCATTAATAAGGTGTGTCGGGA
CACTTTGCGGGACTGGTGTCAACAACTCGGTTTGAGTACTAATGGCAAGAAAATCGAAGT
TTATCTGAGGCTTCATAGGCATGCTTACCCTGAACAACGGCAAGATATGCCTGAAATGTC
ACAAGAGACCAGATTACAGCGATGTTCGAGGAAACGCAAGGCAGTGACCAAGAGAGCAAG
GCTTCAGAGAAGTTATGAGATGAATGAGAGAGCAGAAGAGACCAATACAGTTGAAGTGAT
AACTTCAGCACCGGGAGCCATGTTGGCATCATGGGCAAGAATTGCTGCAAGAGCTGTTCA
GCCTAAGGCTTTGAATTCATGTTCCATTCCTGTTTCTGTTGAGGCCTTTTTGATGCAAGC
CTCTGGCGTCAGGTGGTGTGTGGTCCATGGCAGACTTCTCTCGGCAGACACAAAGGGTTG
GGTACGCCTGCAGTTTCATGCAGGTCAGGCCTGGGTGCCTACCACTCACAGGAGGATGAT
TTCTCTCTTCTTGTTACCTGCCTGCATTTTCCCATCCCCAGGCATAGAAGATAATATGTT
ATGCCCCGACTGTGCTAAGAGGAATAAGAAGATGATGAAAAGATTAATGACAGTAGAGAA
GTAGCAGCAACCTGTTTGAATACAATGTACTAAAGGAGGGATGTACTTTCAGATCATGTA
ACCTATTACGAAGGAGTGGAAGAGGAGACAATTTGAATGAATCCTCATGATCTACAAAAC
AAAATCATAGTGACTAGGACTCCACAGTGAAGATGGTTGACTAGTGACACAGCCCCATCT
AAAGAATCCCTTTCTGTATGTCTGAAAACCCATTAAAATAAAGTCACTGCAATTGGCCTT
GTAAAAAAAAAAA

Protein Sequence

>151871 : length: 308
MSHRARVLLKMSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDV
KLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLS
TNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAE
ETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRL
LSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMM
KRLMTVEK