ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1501

Name

CTNND2

Synonym

GT24|NPRAP;catenin (cadherin-associated protein), delta 2;CTNND2;catenin (cadherin-associated protein), delta 2

Definition

T-cell delta-catenin|catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein)|catenin delta-2|neurojungin

Position

5p15.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cadherin signaling pathway;PANTHER;P00012

Disease

Mental retardation in cri-du-chat syndrome;OMIM

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

1501

Links to epithelial mesenchymal transition gene database

1501

Links to ovarian cancer gene database

1501

Links to endometrial cancer gene database

1501

Links to iHOP

1501

Sequence Information

Nucleotide Sequence

>1501 : length: 5481
GCGTCGGGAGCCGCCTCTCGCCCGCGGCGCTCGCCCCTGCCGCCCGCCAGCATCCCTTGT
CCCGCGGCCGCGCTCAGACAACAAAAGCGGAAGATGCTGCAGTTGGGCAAGGTCAGGACC
TTGCCCTGAAGCCGGGCGGCGCCGCGCACGCCTCTTCCCGGACTGAGGAGCTGTCGCCGG
CGGAGGGTGCATGTTTGCGAGGAAGCCGCCGGGCGCCGCGCCTTTGGGAGCTATGCCTGT
TCCAGACCAGCCTTCATCAGCCTCAGAGAAGACGAGTTCCCTGAGCCCCGGCTTAAACAC
CTCCAACGGGGATGGCTCTGAAACAGAAACCACCTCTGCCATCCTCGCCTCAGTCAAAGA
ACAGGAATTACAGTTTGAAAGGCTGACCCGAGAGCTGGAGGCTGAACGGCAGATCGTAGC
CAGCCAGCTGGAGCGATGCAAGCTCGGATCCGAGACTGGCAGCATGAGCAGCATGAGTTC
AGCAGAAGAGCAGTTTCAGTGGCAGTCACAAGATGGTCAAAAAGATATCGAAGATGAGCT
TACAACAGGTCTCGAGCTGGTGGACTCCTGTATTAGGTCACTACAGGAATCAGGAATACT
TGACCCACAGGATTATTCTACAGGTGAAAGGCCCAGCCTGCTCTCCCAGAGTGCACTTCA
GCTCAATTCCAAACCTGAAGGGTCTTTCCAGTATCCGGCCAGCTACCATAGCAACCAGAC
CCTGGCCCTGGGGGAAACCACCCCTTCACAGCTCCCGGCCCGAGGCACACAAGCCCGAGC
TACGGGCCAGAGCTTCAGCCAGGGCACGACCAGCCGCGCCGGCCACCTGGCGGGGCCCGA
GCCCGCGCCGCCGCCGCCGCCGCCGCCGCGGGAGCCGTTCGCGCCCAGCCTGGGCAGCGC
CTTCCACCTGCCCGACGCGCCGCCCGCCGCCGCCGCCGCCGCGCTCTACTACTCCAGCTC
CACGCTGCCCGCGCCGCCGCGCGGGGGCTCCCCGCTGGCCGCGCCCCAGGGCGGTTCGCC
CACCAAGCTGCAGCGCGGCGGCTCGGCCCCCGAGGGCGCCACCTACGCCGCGCCGCGCGG
CTCCTCGCCCAAGCAGTCGCCCAGCCGCCTGGCCAAGTCCTACAGCACCAGCTCGCCCAT
CAACATCGTCGTGTCCTCGGCCGGCCTGTCCCCGATCCGCGTGACCTCGCCCCCCACCGT
GCAGTCCACCATCTCCTCCTCGCCCATCCACCAGCTGAGCTCCACCATCGGCACGTACGC
CACCCTGTCGCCCACCAAGCGCCTGGTCCACGCGTCCGAGCAGTACAGCAAGCACTCGCA
GGAGCTGTATGCCACGGCCACCCTCCAGAGGCCGGGCAGCCTGGCAGCTGGTTCCCGAGC
CTCATACAGCAGCCAGCATGGGCACCTGGGCCCAGAGTTGCGGGCCCTGCAGTCCCCAGA
ACACCACATAGATCCCATCTATGAAGACCGCGTCTATCAGAAGCCCCCTATGAGGAGTCT
CAGCCAGAGCCAGGGGGACCCTCTGCCGCCAGCACACACCGGCACCTACCGCACGAGCAC
AGCCCCATCTTCCCCTGGTGTCGACTCCGTCCCCTTGCAGCGCACAGGCAGCCAGCACGG
CCCACAGAATGCCGCCGCGGCCACCTTCCAGAGGGCCAGCTATGCCGCCGGCCCAGCCTC
CAATTACGCGGACCCCTACCGACAGCTGCAGTATTGTCCCTCTGTTGAGTCTCCATACAG
CAAATCCGGCCCTGCTCTCCCGCCTGAAGGCACCTTGGCCAGGTCCCCGTCCATTGATAG
CATTCAGAAAGATCCCAGAGAATTTGGATGGAGAGACCCGGAACTGCCGGAAGTGATTCA
GATGTTGCAGCACCAGTTTCCCTCGGTCCAGTCTAACGCGGCAGCCTACTTGCAACACCT
CTGTTTTGGAGACAACAAAATTAAAGCCGAGATAAGGAGACAAGGAGGCATCCAGCTCCT
GGTGGACCTGTTGGATCATCGGATGACCGAAGTCCACCGTAGTGCCTGTGGAGCTCTGAG
AAACCTGGTGTATGGGAAGGCCAACGATGATAACAAAATTGCCCTGAAAAACTGTGGTGG
CATCCCAGCACTGGTGAGGTTACTCCGCAAGACGACTGACCTGGAGATCCGGGAGCTGGT
CACAGGAGTCCTTTGGAACCTCTCCTCATGCGATGCACTCAAAATGCCAATCATCCAGGA
TGCCCTAGCAGTACTGACCAACGCGGTGATTATCCCCCACTCAGGCTGGGAAAATTCGCC
TCTTCAGGATGATCGGAAAATACAGCTGCATTCATCACAGGTGCTGCGTAACGCCACCGG
GTGCCTAAGGAATGTTAGTTCGGCCGGAGAGGAGGCCCGCAGAAGGATGAGAGAGTGTGA
TGGGCTTACGGATGCCTTGCTGTACGTGATCCAGTCTGCGCTGGGGAGCAGTGAGATCGA
TAGCAAGACCGTTGAAAACTGTGTGTGCATTTTAAGGAACCTCTCGTACCGGCTGGCGGC
AGAAACGTCTCAGGGACAGCACATGGGCACGGACGAGCTGGACGGGCTACTCTGTGGCGA
GGCCAATGGCAAGGATGCTGAGAGCTCTGGGTGCTGGGGCAAGAAGAAGAAGAAAAAGAA
ATCCCAAGATCAGTGGGATGGAGTAGGACCTCTTCCAGACTGTGCTGAACCACCAAAAGG
GATCCAGATGCTGTGGCACCCATCAATAGTCAAACCCTACCTCACACTGCTCTCTGAGTG
CTCAAATCCAGACACGCTGGAAGGGGCGGCAGGCGCCCTGCAGAACTTGGCTGCAGGGAG
CTGGAAGTGGTCAGTATATATCCGAGCCGCTGTCCGAAAAGAGAAAGGCCTGCCCATCCT
CGTGGAGCTGCTCCGAATAGACAATGACCGTGTGGTGTGCGCGGTGGCCACTGCGCTGCG
GAACATGGCCTTGGACGTCAGAAATAAGGAGCTCATCGGCAAATACGCCATGCGAGACCT
AGTCCACAGGCTTCCAGGAGGGAACAACAGCAACAACACTGCAAGCAAGGCCATGTCGGA
TGACACAGTGACAGCTGTCTGCTGCACACTGCACGAAGTGATTACCAAGAACATGGAGAA
CGCCAAGGCCTTACGGGATGCCGGTGGCATCGAGAAGTTGGTCGGCATCTCCAAAAGCAA
AGGAGATAAACACTCTCCAAAAGTGGTCAAGGCTGCATCTCAGGTCCTCAACAGCATGTG
GCAGTACCGAGATCTGAGGAGTCTCTACAAAAAGGATGGATGGTCACAATACCACTTTGT
AGCCTCGTCTTCAACCATCGAGAGGGACCGGCAAAGGCCCTACTCCTCCTCCCGCACGCC
CTCCATCTCCCCTGTGCGCGTGTCTCCCAACAACCGCTCAGCAAGTGCCCCAGCTTCACC
TCGGGAAATGATCAGCCTCAAAGAAAGGAAAACAGACTACGAGTGCACCGGCAGCAACGC
CACCTACCACGGAGCTAAAGGCGAACACACTTCCAGGAAAGATGCCATGACAGCTCAAAA
CACTGGAATTTCAACTTTGTATAGGAATTCTTATGGTGCGCCCGCTGAAGACATCAAACA
CAACCAGGTTTCAGCACAGCCAGTCCCACAGGAGCCCAGCAGAAAAGATTACGAGACCTA
CCAGCCATTTCAGAATTCCACAAGAAATTACGATGAGTCCTTCTTCGAGGACCAGGTCCA
CCATCGCCCTCCCGCCAGCGAGTACACCATGCACCTGGGTCTCAAGTCCACCGGCAACTA
CGTTGACTTCTACTCAGCTGCCCGTCCCTACAGTGAACTGAACTATGAAACGAGCCACTA
CCCGGCCTCCCCCGACTCCTGGGTGTGAGGAGCAGGGCACAGGCGCTCCGGGAACAGTGC
ATGTGCATGCATACCACAAGACATTTCTTTCTGTTTTGTTTTTTTCTCCTGCAAATTTAG
TTTGTTAAAGCCTGTTCCATAGGAAGGCTGTGATAACCAGTAAGGAAATATTAAGAGCTA
TTTTAGAAAGCTAAATGAATCGCAAGTTAACTTGGAAATCAGTAGAAAGCTAAAGTGATC
CTAAATATGACAGTGGGCAGCACCTTTCTAGCGTGAGCTGTAGAGTAACGAGAAGTGCTT
TATACTGAACGTGGTTGATGGGAGGAGAGACGAGGCATTCGGGCCGGTGGGGCGTAAGGG
TTATCGTTAAGCACAAGACACAGAATAGTTTACACACTGTGTGGGGGACGGCTTCTCACG
CTTTGTTTACTCTCTTCATCCGTTGTGACTCTAGGCTTCAGGTTGCATTGGGGTTCCTCT
GTACAGCAAGATGTTTCTTGCCTTTTGTTAATGCATTGTTGTAAAGTATTTGATGTACAT
TACAGATTAAAGAAGAAAAGCGCGTTGTGTATATTACACCAATGCCGCCGTGTTTCCTCA
TCTATGGTTCTAAATATTGCTTCAATTTCAAACTTTTGAAAGATGTATGGATTTCCAGTT
TTTCTTTACTTTCTCCCAGTATGTTTTAACAAAAAAAAAAAAAAGCAGGAAAAAAGGAAT
ATTTAGCAGTATTGTTCGTTCTGATATGTGAATTTGTTTGTGACAACTAAACAAGGCATT
CAGCAGTTTCTGACAATTAACATACATCATTCCACACTCCTTGTCAACAAAGTGCTTTTT
CACTGCCTAAAATTTTAGATGTAGATATTTGAAATAGATTTTTTCATTTATACCAGTTTT
CTTTATGATGATACAGTGTTAAAAGAAAATAAATTACAATTGATCTGTCATCCATATTTG
CTAAGAATGTCTATTTCCAAGAACCTATATCTTACAAAATACACATTCTTGCTTGTGTGT
CTGTGTGTGTGGGTGTATGTATGTCCACGTACTAGAAAAATTACCTGTGTGAGATTTTAT
TTTGACAGAAGCTATTTCATTTGCTGTTCATCTTGTACAAACTTTGTTTTTGGTTTTTTA
GTATAAATGTACATCAGTTTGTTCCTTTTGTACTGTATCTATTCTTCTGACCATCTAGTG
ACTCAGGATATTAGGCCAGTTGAAGTGGAGTTATAGGATTTTCACACATTCACGCATACT
TGGATATCAACCCTCTCTACAGGTCCGTTTCCTTACACATTTTATCCCCTCAGAACACGA
TAAACCATGGCCAATTCAGTTTCACTTTGGGGCCAATTACTTGAAGTATCCACAGAAAAT
GTAAACTGCTCGCCTTATTCCCCCAAACTTTTTGTTCATGTGGCAGGGAGCAGTACACAA
CTATGGAATAGATTATTAAAACTGAACTTGAAGCTAACGTTAGAATAGTGGTTAACAGAG
CTAAGAAATAAGGCTAACCATCGAAAAGAACATGGGCCGCGGGTAAACTAGCTTTGCTCT
TTAGATGCAAGTGGCTGAGGCCAATAGGTGCCTAGTAAATGTTAACTGTTCTTGGAAAAA
ATAAAAACATCAGTAACAAAA

Protein Sequence

>1501 : length: 1250
MFARKPPGAAPLGAMPVPDQPSSASEKTSSLSPGLNTSNGDGSETETTSAILASVKEQEL
QFERLTRELEAERQIVASQLERCKLGSETGSMSSMSSAEEQFQWQSQDGQKDIEDELTTG
LELVDSCIRSLQESGILDPQDYSTGERPSLLSQSALQLNSKPEGSFQYPASYHSNQTLAL
GETTPSQLPARGTQARATGQSFSQGTTSRAGHLAGPEPAPPPPPPPREPFAPSLGSAFHL
PDAPPAAAAAALYYSSSTLPAPPRGGSPLAAPQGGSPTKLQRGGSAPEGATYAAPRGSSP
KQSPSRLAKSYSTSSPINIVVSSAGLSPIRVTSPPTVQSTISSSPIHQLSSTIGTYATLS
PTKRLVHASEQYSKHSQELYATATLQRPGSLAAGSRASYSSQHGHLGPELRALQSPEHHI
DPIYEDRVYQKPPMRSLSQSQGDPLPPAHTGTYRTSTAPSSPGVDSVPLQRTGSQHGPQN
AAAATFQRASYAAGPASNYADPYRQLQYCPSVESPYSKSGPALPPEGTLARSPSIDSIQK
DPREFGWRDPELPEVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQGGIQLLVDL
LDHRMTEVHRSACGALRNLVYGKANDDNKIALKNCGGIPALVRLLRKTTDLEIRELVTGV
LWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKIQLHSSQVLRNATGCLR
NVSSAGEEARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCVCILRNLSYRLAAETS
QGQHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQWDGVGPLPDCAEPPKGIQM
LWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAAGSWKGWAEDVAGMAYALRSLPEGAP
CLPQWSVYIRAAVRKEKGLPILVELLRIDNDRVVCAVATALRNMALDVRNKELIGKYAMR
DLVHRLPGGNNSNNTASKAMSDDTVTAVCCTLHEVITKNMENAKALRDAGGIEKLVGISK
SKGDKHSPKVVKAASQVLNSMWQYRDLRSLYKKDGWSQYHFVASSSTIERDRQRPYSSSR
TPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTA
QNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQ
VHHRPPASEYTMHLGLKSTGNYVDFYSAARPYSELNYETSHYPASPDSWV