ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

149013

Name

NBPF12

Synonym

COAS1|KIAA1245;neuroblastoma breakpoint family, member 12;NBPF12;neuroblastoma breakpoint family, member 12

Definition

chomosome one amplified sequence 1 cyclophilin|chromosome 1 amplified sequence 1|neuroblastoma breakpoint family member 12

Position

1q21

Gene Type

protein-coding

External Links

Links to cell senescence gene database

149013

Links to epithelial mesenchymal transition gene database

149013

Links to ovarian cancer gene database

149013

Links to endometrial cancer gene database

149013

Links to iHOP

149013

Sequence Information

Nucleotide Sequence

>149013 : length: 7109
ATTACTCGTTTTCTCCGCCCGCGGCCCGAACCCGTTGTGCGGTAGAGGCAGCCGGGTCCC
TTTAAGGCCCAGCTGCGCTCCGTCCTCCATTACTCCTTTTCTCCGCCCGCGGCCCGAACC
CGTTGTGCGGTAGAGGCAGCCGGGTCCCTTTAAGGCCCAGCTGCGCCTGTGCCTTGGGCT
CTCCTGACACGGCCCATCCGGACCCTGAGGAGCCAGCGGGCCGCAAGCAAGTTGCTGGGC
GGCGGTTGAGATAGCGGCGGTGCTGGGAGGGGTAGGTGAGGGTCGCGAGGCTGCCTGAGC
TTCTGAGTGAGCCTGGTGATTTTGGGAACGCGGGACGGGCGACCTGCGGCGCCAGGAGCG
GGGCCGAGGTACGGCGGCACGGCTGCAGCCTGGATGGGAAGTTCAAGTTTACTGCGAAGT
CCACCCAGCGTTCCGGAGGTGAGGGCGCCGCGCCAGGCCGGGCGGCAGGCATTCTGAAGG
CAAATCCTGTTTAGACCCAGGCAAAGGTTCCTGGTGACCCAGGCTCTCATGAGCAGATTG
TCCCTTATCATTCTCCTGAGGATGTCTGGAGCTTCAGTGCTGTGTGCTCTTGGCCTCCAC
ACTGGGGGTGCCACCAACTCCCACTGTCCAGGGCTTCTGGTGGACTCTCCGAGGCACCGA
TGTAGAAACTTACCCATTCAGTGCACCAAGAGCAGCCTCACATGGTGTGGGCCGACATGA
AGAGCTGCCAGATCCAACAGTTCTCAGAATTCTTCATATATTTTGGACAGCAGTTTTTCC
ATCAGATTATTTTAAATGTGATTGATAACAGTAAAGCCACACTCCTCAAGTGCCTGAAAT
ACCCCTCATTGTCTTCTTCAGGTGGCAAGGGCTCTGGAACAGCCACATAAAGCCCTTGAA
GATAAGGATGGTCAAACAAAATAATATCATACCTGGAGAAACTCAGATCTTGCTAAGATT
TACTGGTTGGGAATCCAAAGTTAATGCCAAGAAGCAGCTGCCAGTTGGGATCAAATGTGA
GCCTATGGATCAAGACGGTTACCTGGCACGCTGGCCACAATCTACCTCACTCTTATCAGA
GTCTGAGCAGTGCTTTCAGCTCTGAGTTGAGGCACCTCGAACCTTGTTTTTGTGGTGAAG
GATCCTAAAGTGCTGTGGGGAGTGATCACATTTTTCACAACATCCCTGACTCCACCTCTT
CTGCCACAAACGTCAGCATGGTGGTATCAGCCGGCCCTTGGTCCAGCGAGAAGGCAGAGA
TGAACATTCTAGAAATCAACGAGAAATTGCGCCCCCAGTTGGCAGAGAACAAACAGCAGT
TCAGAAACCTCAAAGAGAGATGTTTTCTAACTCAACTGGCCGGCTTCCTGGCCAACCGAC
AGAAGAAATACAAGTATGAAGAGTGTAAAGACCTCATAAAATTTATGCTGAGGAATGAGC
GACAGTTCAAGGAGGAGAAGCTTGCAGAGCAGCTGAAACAAGCTGAGGAGCTCAGGCAAT
ATAAAGTCCTGGTTCACTCTCAGGAACGAGAGCTGACCCAGTTAAGGGAGAAGTTACGGG
AAGGGAGAGATGCCTCCCGCTCATTGAATGAGCATCTCCAGGCCCTCCTCACTCCGGATG
AGCCGGACAAGTCCCAGGGGCAGGACCTCCAAGAACAGCTGGCTGAGGGGTGTAGACTGG
CACAGCAACTTGTCCAAAAGCTCAGCCCAGAAAATGATGAAGATGAGGATGAAGATGTTC
AAGTTGAGGAGGATGAGAAAGTACTGGAATCATCTGCCCCCAGGGAGGTGCAGAAGGCTG
AAGAGAGCAAAGTCCCTGAGGACTCACTGGAGGAATGTGCCATCACTTGTTCAAATAGCC
ACGGCCCTTGTGACTCCATCCAGCCTCACAAGAACATCAAAATCACATTTGAGGAAGACA
AAGTCAACTCAACTGTGGTTGTAGACAGAAAATCCTCTCATGATGAATGTCAGGATGCTC
TAAACATTCTCCCAGTCCCTGGCCCCACCTCTTCTGCCACAAACGTCAGCATGGTGGTAT
CAGCCGGCCCTTTGTCCAGCGAGAAGGCAGAGATGAACATTCTAGAAATCAATGAGAAGT
TGCGCCCCCAGCTGGCAGAGAAGAAACAGCAGTTCAGAAGCCTCAAAGAGAAATGTTTTG
TAACTCAACTGGCCGGCTTCCTGGCCAAGCAGCAGAACAAATACAAATATGAAGAGTGCA
AAGACCTCATAAAATCTATGCTGAGGAATGAGCTACAGTTCAAGGAGGAGAAGCTTGCAG
AGCAGCTGAAGCAAGCTGAGGAGCTCAGGCAATATAAAGTCCTGGTTCACTCTCAGGAAC
GAGAGCTGACCCAGTTAAGGGAGAAGTTACGGGAAGGGAGAGATGCCTCCCGCTCATTGA
ATGAGCATCTCCAGGCCCTCCTCACTCCGGATGAGCCGGACAAGTCCCAGGGGCAGGACC
TCCAAGAACAGCTGGCTGAGGGGTGTAGACTGGCACAGCACCTTGTCCAAAAGCTCAGCC
CAGAAAATGATGAAGATGAGGATGAAGATGTTCAAGTTGAGGAGGATGAGAAAGTGCTGG
AATCATCTTCCCCCAGGGAGATGCAGAAGGCTGAAGAAAGCAAAGTCCCTGAGGACTCAC
TGGAGGAATGTGCCATCACTTGTTCAAATAGCCACGGCCCTTGTGACTCCAACCAGCCTC
ACAAGAACATCAAAATCACATTTGAGGAAGACAAAGTCAACTCATCTCTGGTTGTAGACA
GAGAATCCTCTCATGATGAATGTCAGGATGCTCTAAACATTCTCCCAGTCCCTGGCCCCA
CCTCTTCTGCCACAAACGTCAGCATGGTGGTATCAGCCGGCCCTTTGTCCAGCGAGAAGG
CAGAGATGAACATTCTAGAAATCAATGAGAAGTTGCGCCCCCAGCTGGCAGAGAAGAAAC
AGCAGTTCAGAAGCCTCAAAGAGAAATGTTTTGTAACTCAAGTGGCCTGCTTCCTGGCCA
AGCAGCAGAACAAATACAAATATGAAGAGTGCAAAGACCTCCTAAAATCTATGCTGAGGA
ATGAGCTACAGTTCAAGGAGGAGAAGCTTGCAGAGCAGCTGAAGCAAGCTGAGGAGCTCA
GGCAATATAAAGTCCTGGTTCACTCTCAGGAACGAGAGCTGACCCAGTTAAGGGAGAAGT
TACGGGAAGGGAGAGATGCCTCCCGCTCATTGAATGAGCATCTCCAGGCCCTCCTCACTC
CGGATGAGCCGGACAAGTCCCAGGGGCAGGACCTCCAAGAACAGCTGGCTGAGGGGTGTA
GACTGGCACAACACCTTGTCCAAAAGCTCAGCCCAGAAAATGATAACGATGACGATGAAG
ATGTTCAAGTTGAGGTGGCTGAGAAAGTGCAGAAATCGTCTTCCCCCAGGGAGATGCAGA
AGGCTGAAGAAAAGGAAGTCCCTGAGGACTCACTGGAGGAGTGTGCCATCACTTGTTCAA
ATAGCCATGGCCCTTATGACTCCAACCAGCCACATAGGAAAACCAAAATCACATTTGAGG
AAGACAAAGTCGACTCAACTCTCATTGGCTCATCCTCTCATGTTGAATGGGAGGATGCTG
TACACATTATCCCAGAAAATGAAAGTGATGATGAGGAAGAGGAAGAAAAAGGGCCAGTGT
CTCCCAGGAATCTGCAGGAGTCTGAAGAGGAGGAAGTCCCCCAGGAGTCCTGGGATGAAG
GTTATTCGACTCTCTCAATTCCTCCTGAAAGGTTGGCCTCATACCAGTCTTACAGCAGCA
CATTTCACTCATTAGAGGAACAGCAAGTCTGCATGGCTGTTGACATAGGCAGACATCGGT
GGGATCAAGTGAAAAAGGAGGACCAAGAGGCAACAGGTCCCAGGCTCAGCAGGGAGCTGC
TGGCTGAGAAAGAGCCTGAAGTCTTGCAGGACTCACTGGATAGATGTTATTCAACTCCTT
CAGTTTATCTTGGACTGACTGACTCATGCCAGCCCTACAGAAGTGCCTTTTACGTATTGG
AGCAACAGCGTGTTGGCTTGGCTGTTGACATGGATGAAATTGAAAAGTACCAAGAAGTGG
AAGAAGACCAAGACCCATCATGCCCCAGGCTCAGCAGGGAGCTGCTGGCTGAGAAAGAGC
CTGAAGTCTTGCAGGACTCACTGGATAGATGTTATTCGACTCCTTCAGGTTATCTTGAAC
TGCCTGACTTAGGCCAGCCCTACAGAAGTGCTGTTTACTCATTGGAGGAACAGTACCTTG
GCTTGGCTCTTGACGTGGACAGAATTAAAAAGGACCAAGAAGAGGAAGAAGACCAAGGCC
CACCATGCCCCAGGCTCAGCAGGGAGCTGCTGGAGGTAGTAGAGCCTGAAGTCTTGCAGG
ACTCACTGGATAGATGTTATTCAACTCCTTCCAGTTGTCTTGAACAGCCTGACTCCTGCC
AGCCCTACAGAAGTTCCTTTTATGCATTGGAGGAAAAACATGTTGGCTTTTCTCTTGACG
TGGGAGAAATTGAAAAGAAGGGGAAGGGGAAGAAAAGAAGGGGAAGAAGATCAAAGAAGA
AAAGAAGAAGGGGAAGAAAAGAAGGGGAAGAAGATCAAAACCCACCATGCCCCAGGCTCA
GCAGGGAGCTGCTGGCTGAGAAAGAGCCTGAAGTCTTGCAGGACTCACTGGATAGATGGT
ATTCGACTCCTTCAGTTTATCTTGGACTGACTGACCCATGCCAGCCCTACAGAAGTGCCT
TTTACGTATTGGAGCAACAGCGTGTTGGCTTGGCTGTTGACATGGATGAAATTGAAAAGT
ACCAAGAAGTGGAAGAAGACCAAGACCCATCATGCCCCAGGCTCAGCAGGGAGCTGCTGG
CTGAGAAAGAGCCTGAAGTCTTGCAGGACTCACTGGATAGATGTTATTCGACTCCTTCAG
GTTATCTTGAACTGCCTGACTTAGGCCAGCCCTACAGAAGTGCTGTTTACTCATTGGAGG
AACAGTACCTTGGCTTGGCTCTTGACGTGGACAGAATTAAAAAGGACCAAGAAGAGGAAG
AAGACCAAGGCCCACCATGCCCCAGGCTCAGCAGGGAGCTGCTGGAGGTAGTAGAGCCTG
AAGTCTTGCAGGACTCACTGGATAGATGTTATTCAACTCCTTCCAGTTGTCTTGAACAGC
CTGACTCCTGCCAGCCCTACAGAAGTTCCTTTTATGCATTGGAGGAAAAACATGTTGGCT
TTTCTCTTGACGTGGGAGAAATTGAAAAGAAGGGGAAGGGGAAGAAAAGAAGGGGAAGAA
GATCAAAGAAGAAAAGAAGAAGGGGAAGAAAAGAAGGGGAAGAAGATCAAAACCCACCAT
GCCCCAGGCTCAACAGCGTGCTGATGGAAGTGGAAGAGCCTGAAGTCTTGCAGGACTCAC
TGGATAGATGTTATTCGACTCCATCAATGTACTTTGAACTACCTGACTCATTCCAGCACT
ACAGAAGTGTGTTTTACTCATTTGAGGAACAGCACATCACCTTTGCCCTTGACATGGACA
ATAGCTTTTTTACTTTGACGGTGACAAGTCTCCACCTGGTCTTCCAGATGGGAGTCATAT
TCCCACAATAAGCAGCCCTTACTAAGCCGAGAGGTTTCATTCCTGCAGGCAGGACCTATA
GGCACCTGAAGATTTGAATGAAACTATAGTTCCATTTGGAAGCCCAGACATAGGATGGGT
CAGTGGGCATGGCTCTATTCCTATTCTCAGAGCATGCCAGTGGCAACCTGTGCTCAGTCT
GAAGACAATGGACCCACGTTAGGTGTGACACGTTCACATAACTGTGCAGCACATGCCGGG
AGTGATCAGCCGGACATTTTAATTTGAACCATGTATCTCTGGGTAGCTACAAAATTCCTC
AGGGATTTCATTTTGCAGGCATGTCTCTGAGCTTCTATACCTACTCAAGGTCAGTGTCAT
CTTTGTGTTTAGTTCATCCAAAGGTGTTACCCTGGTTTCAATGAACCTAACCTCATTATT
TGTGTCTTCAGTGTTGGCTTGTTTTAGCTGATCCATCTGTAACACAGGAGGGATCCTTGG
CTGAGGATTGTATTTCAGAACCACCAACTGCTCTTGACAATTGTTAACCCACTAGGCTCC
TTTGGTTAGAGAAGCCACAGTCCTTCAGCCTCCAATTGGTGTCAGTACTTAGGAAGACCA
CAGCTAGATGGACAAACAGCATTGGGAGGCCTTAGCCCTGCTCCTCTCAATTCCATCCTG
TAGAGAACAGGAGTCAGGAGCCGCTGGCAGGAGACAGCATGTCACCCAGGACTCTGCCGG
TGCAGAATATGAGCAATGCCATGTTCTTGCAGAAAACGCTTAGCCTGAGTTTCATAGGAG
GTAATCACCAGACAACTGCAGAATGTAGAACACTGAGCAGGACAACTGACCTGTCTCCTT
CACATAGTCCATATCACCACAAATCACACAACAAAAAGGAGAAGAGATATTTTGGGTTGA
AAAAAAGTAAAAAGATAATGTAGCTGCATTTCTTTAGTTATTTTGAACCCCAAATATTTC
CTCATCTTTTTGTTGTTGTCATTGATGGTGGTGACATGGACTTGTTTATAGAGGACAGGT
CAGCTCTCTGGCTCAATGATCTACATTCTGAAGTTGTCTGAAAATGTCTTCATGATTAAA
TTCAGCCTAAACTTTTTGCTGGGAACACTGCAGAGACAATGCTGTGAGTTTCCAACCTCA
GCCCATCTGCGGGCAGAGAAGGTCTAGTTTGTCCATCACCATTATGATATCAGGACTGGT
TACTTGGTTAAGGAGGGGTCTAGGAGATCTGTCCCTTTTAGAGACACCTTACTTATAATG
AAGTACTTGGGAAAGCGGTTTTCAAGAGTATAAATATCCTGTATTCTAATGATCATCCTC
TAAACATTTTATCATTTATTAATCCTCCCTGCCTGTGTCTATTATTATATACATATCTCT
ACGCTGCAAATTTTGGGTCTCAATTTTTACTGTGCCTTTGTTTTTACTAGTGTCTGCTGT
TGCAAAAAGAAGAAAACATTCTCTGCCTGAGTTTTAATTTTTGTCCAAAGTTAATTTTAA
TCTATACAATTAAAACCTTTTGCCTATCA

Protein Sequence

>149013 : length: 1457
MVVSAGPWSSEKAEMNILEINEKLRPQLAENKQQFRNLKERCFLTQLAGFLANRQKKYKY
EECKDLIKFMLRNERQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLREKLREGRDAS
RSLNEHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQQLVQKLSPENDEDEDEDVQVEEDE
KVLESSAPREVQKAEESKVPEDSLEECAITCSNSHGPCDSIQPHKNIKITFEEDKVNSTV
VVDRKSSHDECQDALNILPVPGPTSSATNVSMVVSAGPLSSEKAEMNILEINEKLRPQLA
EKKQQFRSLKEKCFVTQLAGFLAKQQNKYKYEECKDLIKSMLRNELQFKEEKLAEQLKQA
EELRQYKVLVHSQERELTQLREKLREGRDASRSLNEHLQALLTPDEPDKSQGQDLQEQLA
EGCRLAQHLVQKLSPENDEDEDEDVQVEEDEKVLESSSPREMQKAEESKVPEDSLEECAI
TCSNSHGPCDSNQPHKNIKITFEEDKVNSSLVVDRESSHDECQDALNILPVPGPTSSATN
VSMVVSAGPLSSEKAEMNILEINEKLRPQLAEKKQQFRSLKEKCFVTQVACFLAKQQNKY
KYEECKDLLKSMLRNELQFKEEKLAEQLKQAEELRQYKVLVHSQERELTQLREKLREGRD
ASRSLNEHLQALLTPDEPDKSQGQDLQEQLAEGCRLAQHLVQKLSPENDNDDDEDVQVEV
AEKVQKSSSPREMQKAEEKEVPEDSLEECAITCSNSHGPYDSNQPHRKTKITFEEDKVDS
TLIGSSSHVEWEDAVHIIPENESDDEEEEEKGPVSPRNLQESEEEEVPQESWDEGYSTLS
IPPERLASYQSYSSTFHSLEEQQVCMAVDIGRHRWDQVKKEDQEATGPRLSRELLAEKEP
EVLQDSLDRCYSTPSVYLGLTDSCQPYRSAFYVLEQQRVGLAVDMDEIEKYQEVEEDQDP
SCPRLSRELLAEKEPEVLQDSLDRCYSTPSGYLELPDLGQPYRSAVYSLEEQYLGLALDV
DRIKKDQEEEEDQGPPCPRLSRELLEVVEPEVLQDSLDRCYSTPSSCLEQPDSCQPYRSS
FYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSKKKRRRGRKEGEEDQNPPCPRLSRELLA
EKEPEVLQDSLDRWYSTPSVYLGLTDPCQPYRSAFYVLEQQRVGLAVDMDEIEKYQEVEE
DQDPSCPRLSRELLAEKEPEVLQDSLDRCYSTPSGYLELPDLGQPYRSAVYSLEEQYLGL
ALDVDRIKKDQEEEEDQGPPCPRLSRELLEVVEPEVLQDSLDRCYSTPSSCLEQPDSCQP
YRSSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSKKKRRRGRKEGEEDQNPPCPRLNS
VLMEVEEPEVLQDSLDRCYSTPSMYFELPDSFQHYRSVFYSFEEQHITFALDMDNSFFTL
TVTSLHLVFQMGVIFPQ