ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1490

Name

CTGF

Synonym

CCN2|HCS24|IGFBP8|NOV2;connective tissue growth factor;CTGF;connective tissue growth factor

Definition

CCN family member 2|IBP-8|IGF-binding protein 8|IGFBP-8|hypertrophic chondrocyte-specific protein 24|insulin-like growth factor-binding protein 8

Position

6q23.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

Metabolism of lipids and lipoproteins;Reactome;REACT:22258

Pathway

amb2 Integrin signaling;PID Curated;200108

Disease

Scleroderma;FunDO

Disease

Muscular dystrophies;FunDO

Disease

Lung cancer;FunDO

Disease

Biliary Atresia;FunDO

Disease

Osteosarcoma;FunDO

Disease

Liver cancer;FunDO

Disease

Stomach cancer;FunDO

Disease

Breast cancer;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Embryoma;FunDO

Disease

Gallbaldder cancer;FunDO

Disease

Chronic rejection of renal transplant;FunDO

Disease

Systemic scleroderma;FunDO

Disease

Liver disease;FunDO

Disease

Pancreas cancer;FunDO

Disease

Kidney disease;FunDO

Disease

Drug abuse;FunDO

Disease

Fibroid tumor;FunDO

Disease

Proteinuria;FunDO

Disease

Malaria;FunDO

Disease

Brain tumor;FunDO

Disease

Hypertension;FunDO

Disease

Squamous cell cancer;FunDO

Disease

Gouts;FunDO

Disease

IGA glomerulonephritis;FunDO

Disease

Metastasis to lymph nodes;FunDO

Disease

Ovarian cancer;FunDO

Disease

Congenital abnormality;FunDO

External Links

Links to cell senescence gene database

1490

Links to epithelial mesenchymal transition gene database

1490

Links to ovarian cancer gene database

1490

Links to endometrial cancer gene database

1490

Links to iHOP

1490

Sequence Information

Nucleotide Sequence

>1490 : length: 2358
AAACTCACACAACAACTCTTCCCCGCTGAGAGGAGACAGCCAGTGCGACTCCACCCTCCA
GCTCGACGGCAGCCGCCCCGGCCGACAGCCCCGAGACGACAGCCCGGCGCGTCCCGGTCC
CCACCTCCGACCACCGCCAGCGCTCCAGGCCCCGCCGCTCCCCGCTCGCCGCCACCGCGC
CCTCCGCTCCGCCCGCAGTGCCAACCATGACCGCCGCCAGTATGGGCCCCGTCCGCGTCG
CCTTCGTGGTCCTCCTCGCCCTCTGCAGCCGGCCGGCCGTCGGCCAGAACTGCAGCGGGC
CGTGCCGGTGCCCGGACGAGCCGGCGCCGCGCTGCCCGGCGGGCGTGAGCCTCGTGCTGG
ACGGCTGCGGCTGCTGCCGCGTCTGCGCCAAGCAGCTGGGCGAGCTGTGCACCGAGCGCG
ACCCCTGCGACCCGCACAAGGGCCTCTTCTGTGACTTCGGCTCCCCGGCCAACCGCAAGA
TCGGCGTGTGCACCGCCAAAGATGGTGCTCCCTGCATCTTCGGTGGTACGGTGTACCGCA
GCGGAGAGTCCTTCCAGAGCAGCTGCAAGTACCAGTGCACGTGCCTGGACGGGGCGGTGG
GCTGCATGCCCCTGTGCAGCATGGACGTTCGTCTGCCCAGCCCTGACTGCCCCTTCCCGA
GGAGGGTCAAGCTGCCCGGGAAATGCTGCGAGGAGTGGGTGTGTGACGAGCCCAAGGACC
AAACCGTGGTTGGGCCTGCCCTCGCGGCTTACCGACTGGAAGACACGTTTGGCCCAGACC
CAACTATGATTAGAGCCAACTGCCTGGTCCAGACCACAGAGTGGAGCGCCTGTTCCAAGA
CCTGTGGGATGGGCATCTCCACCCGGGTTACCAATGACAACGCCTCCTGCAGGCTAGAGA
AGCAGAGCCGCCTGTGCATGGTCAGGCCTTGCGAAGCTGACCTGGAAGAGAACATTAAGA
AGGGCAAAAAGTGCATCCGTACTCCCAAAATCTCCAAGCCTATCAAGTTTGAGCTTTCTG
GCTGCACCAGCATGAAGACATACCGAGCTAAATTCTGTGGAGTATGTACCGACGGCCGAT
GCTGCACCCCCCACAGAACCACCACCCTGCCGGTGGAGTTCAAGTGCCCTGACGGCGAGG
TCATGAAGAAGAACATGATGTTCATCAAGACCTGTGCCTGCCATTACAACTGTCCCGGAG
ACAATGACATCTTTGAATCGCTGTACTACAGGAAGATGTACGGAGACATGGCATGAAGCC
AGAGAGTGAGAGACATTAACTCATTAGACTGGAACTTGAACTGATTCACATCTCATTTTT
CCGTAAAAATGATTTCAGTAGCACAAGTTATTTAAATCTGTTTTTCTAACTGGGGGAAAA
GATTCCCACCCAATTCAAAACATTGTGCCATGTCAAACAAATAGTCTATCAACCCCAGAC
ACTGGTTTGAAGAATGTTAAGACTTGACAGTGGAACTACATTAGTACACAGCACCAGAAT
GTATATTAAGGTGTGGCTTTAGGAGCAGTGGGAGGGTACCAGCAGAAAGGTTAGTATCAT
CAGATAGCATCTTATACGAGTAATATGCCTGCTATTTGAAGTGTAATTGAGAAGGAAAAT
TTTAGCGTGCTCACTGACCTGCCTGTAGCCCCAGTGACAGCTAGGATGTGCATTCTCCAG
CCATCAAGAGACTGAGTCAAGTTGTTCCTTAAGTCAGAACAGCAGACTCAGCTCTGACAT
TCTGATTCGAATGACACTGTTCAGGAATCGGAATCCTGTCGATTAGACTGGACAGCTTGT
GGCAAGTGAATTTGCCTGTAACAAGCCAGATTTTTTAAAATTTATATTGTAAATATTGTG
TGTGTGTGTGTGTGTGTATATATATATATATGTACAGTTATCTAAGTTAATTTAAAGTTG
TTTGTGCCTTTTTATTTTTGTTTTTAATGCTTTGATATTTCAATGTTAGCCTCAATTTCT
GAACACCATAGGTAGAATGTAAAGCTTGTCTGATCGTTCAAAGCATGAAATGGATACTTA
TATGGAAATTCTGCTCAGATAGAATGACAGTCCGTCAAAACAGATTGTTTGCAAAGGGGA
GGCATCAGTGTCCTTGGCAGGCTGATTTCTAGGTAGGAAATGTGGTAGCCTCACTTTTAA
TGAACAAATGGCCTTTATTAAAAACTGAGTGACTCTATATAGCTGATCAGTTTTTTCACC
TGGAAGCATTTGTTTCTACTTTGATATGACTGTTTTTCGGACAGTTTATTTGTTGAGAGT
GTGACCAAAAGTTACATGTTTGCACCTTTCTAGTTGAAAATAAAGTGTATATTTTTTCTA
TAAAAAAAAAAAAAAAAA

Protein Sequence

>1490 : length: 349
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA