ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1488

Name

CTBP2

Synonym

C-terminal binding protein 2;CTBP2;C-terminal binding protein 2

Definition

C-terminal-binding protein 2|ribeye

Position

10q26.13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch signaling pathway;KEGG PATHWAY;hsa04330

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Wnt signaling pathway;PANTHER;P00057

Disease

prostate cancer;GAD

Disease

CANCER;GAD

Disease

Prostate cancer;NHGRI

External Links

Links to cell senescence gene database

1488

Links to epithelial mesenchymal transition gene database

1488

Links to ovarian cancer gene database

1488

Links to endometrial cancer gene database

1488

Links to iHOP

1488

Sequence Information

Nucleotide Sequence

>1488 : length: 4752
CCAGTTGGTTGTCCCTGCCGTCTCGGAAGGGTTAGCACACAGCCAGGTCTGTTTTTGATG
TATGTAATTGAAGATTTATAAAGAAAAGCTTCTCCTCTGCCTCATCCGCAGTCATTTTTT
TTCCAATGCCAGTTCCCAGCAGGCATATAAATATTGGTCGTTCTCAGAGCTGGGATGCTG
CTGGGTGGTACGAGGGCCCCTGGGAGAACGCCGAGTCCCTGCGGCCTCTGGGGAGGAGAA
GCTCCCTGACGTATGGCACAGCAGAGGGGACTTGGTTTGAGCCAAACCACCGACCACAGG
ACGCTGCCCTGCCCGTGGCCGCCGAGCCCTACCTGTACCGGGAGGCCGTTTATAACTCAG
TGGCTGCAAGAAAGGGGTCTACTCCTGACTTCACCTTCTACGACAGCAGACAGGCAGTGA
TGTCTGGTCGCAGCCCCCTGCTGCCACGGGAGTACTACAGTGATCCGTCTGGAGCTGCTA
GGGTACCCAAAGAGCCTCCCCTCTATCGGGACCCAGGAGTCAGCCGGCCGGTCCCCAGCT
ACGGAGTGCTTGGCAGCAGAACGTCATGGGATCCAATGCAAGGCCGGTCACCTGCCCTGC
AGGACGCCGGTCACCTGTACCGGGATCCTGGAGGTAAAATGATCCCTCAGGGGCGGCAGA
CACAGAGCAGGGCTGCATCTCCCGGGCGGTATGGACGGGAGCAGCCCGACACCAGGTATG
GGGCGGAGGTGCCTGCCTACCCCCTCAGCCAGGTCTTCAGCGACATCAGCGAAAGACCCA
TTGACCCTGCCCCTGCCAGACAGGTGGCCCCGACGTGCCTGGTTGTGGACCCCAGTTCAG
CTGCTGCCCCCGAAGGCAGCACAGGGGTGGCCCCAGGGGCCCTGAATCGTGGCTACGGGC
CTGCCCGGGAAAGCATCCCATCCAAGATGGCTTACGAGACTTACGAAGCTGACCTGTCCA
CCTTCCAGGGTCCTGGTGGCAAGAGGACCGTGCTCCCTGAGTTCCTGGCCTTTCTGCGGG
CGGAGGGGCTGGCAGAGGCCACGCTGGGAGCCCTACTGCAGCAGGGCTTTGACTCCCCGG
CCGTCCTGGCTACCCTGGAGGACGCGGATATCAAGTCTGTCGCACCCAACCTGGGCCAGG
CCCGTGTTCTGAGCCGCCTGGCCAATAGCTGCAGGACCGAAATGCAGCTGCGGAGGCAGG
ACCGGGGGGGCCCGCTGCCCCGGGCGCGGTCCAGCAGCTTCAGCCACCGAAGCGAACTGC
TCCATGGTGACTTGGCTTCTCTGGGCGCTGCGGCTCCTCTGCAGACAGCATCCCCCCGAG
CTGGAGACCCGGCTCGCCGTCCCTCCAGCGCACCATCTCAGCACCTCCTGGAGACGGCAG
CCACCTATTCTGCCCCTGGCGTGGGCACCCATGCCCCACACTTCCCCTCCAACTCCGGGT
ACAGCTCTCCCACCCCTTGCGCCCTGACAGCGCGTCTGAGCCCCACGTACCCCCTGCAGG
CAGGGGTGGCCTTGACTAACCCGGGCCCCTCAAACCCCCTTCACCCAGGCCCCAGAACAG
CCTACTCCACGGCATACACGGTGCCCATGGAGCTGCTAAAGAGGGAGCGCAACGTGGCCG
CCTCTCCGCTGCCCAGCCCTCACGGCAGCCCCCAGGTCTTGCGGAAGCCAGGTGCACCCC
TGGGGCCATCCACCCTGCCGCCGGCCAGCCAGAGCCTCCACACGCCTCACTCACCGTACC
AGAAGGTGGCCCGGCGCACAGGGGCACCCATCATCGTGTCCACCATGCTTGCACCAGAAC
CAAGTATCCGCCCCCAGATCATGAACGGCCCCCTGCACCCCCGCCCCCTGGTGGCGCTGC
TGGACGGCCGCGACTGCACTGTGGAGATGCCCATCCTGAAGGACCTGGCCACTGTGGCCT
TCTGTGACGCGCAGTCGACGCAGGAAATCCACGAGAAGGTTCTAAACGAAGCCGTGGGCG
CCATGATGTACCACACCATCACCCTCACCAGGGAGGACCTGGAGAAGTTCAAGGCCCTGA
GAGTGATCGTGCGGATAGGCAGTGGCTATGACAACGTGGACATCAAGGCTGCCGGCGAGC
TCGGAATTGCCGTGTGCAACATCCCGTCTGCAGCCGTGGAAGAGACAGCGGACTCTACCA
TCTGCCACATCCTCAACCTGTACCGGAGGAACACGTGGCTGTACCAGGCACTGCGGGAAG
GCACGCGGGTTCAGAGCGTGGAGCAGATCCGCGAGGTGGCCTCGGGAGCGGCCCGCATCC
GTGGGGAGACGCTGGGCCTCATTGGCTTTGGTCGCACGGGGCAGGCGGTTGCAGTTCGAG
CCAAGGCCTTTGGATTCAGCGTCATATTTTATGACCCCTACTTGCAGGATGGGATCGAGC
GGTCCCTGGGCGTGCAGAGGGTCTACACCCTGCAGGATTTGCTGTATCAGAGCGACTGCG
TCTCCTTGCACTGCAATCTCAACGAACATAACCACCACCTCATCAATGACTTTACCATAA
AGCAGATGAGGCAGGGAGCATTCCTTGTGAACGCAGCCCGTGGCGGCCTGGTGGACGAGA
AAGCCTTAGCACAAGCCCTCAAGGAGGGCAGGATACGAGGGGCAGCCCTCGACGTGCATG
AGTCAGAGCCCTTCAGCTTTGCTCAGGGTCCGTTGAAAGATGCCCCGAATCTCATCTGCA
CTCCTCACACTGCCTGGTACAGTGAGCAGGCGTCACTGGAGATGAGGGAGGCAGCTGCCA
CCGAGATCCGCCGAGCCATCACAGGTCGCATCCCAGAAAGCTTAAGAAATTGTGTGAACA
AGGAATTCTTTGTCACATCAGCGCCTTGGTCAGTAATAGACCAGCAAGCAATTCATCCTG
AGCTCAATGGTGCCACATACAGATATCCGCCAGGCATCGTGGGTGTGGCTCCAGGAGGAC
TTCCTGCAGCCATGGAAGGGATCATCCCTGGAGGCATCCCAGTGACTCACAACCTCCCGA
CAGTGGCACATCCTTCCCAAGCGCCCTCTCCCAACCAGCCCACAAAACACGGGGACAATC
GAGAGCACCCCAACGAGCAATAGCAGAGAATGCCAGAAGGTAATCACTCAGATACACTTG
GGACCAAGAGACAGTGAAAAATAGATGAACTAAGAGAAAAAGAATCGGATGGTCTTTGTA
ACTGATTCTGGACATATGCATCATTGATGTTGCAGTGTTGAAACTACAAGAGCTAGAAAA
CTGAAGATGTCGTCTGCTTACGGAAGCGCTGAAAGACTAGGATGTGATTTATTAACGACC
AACTTCTGTTATTGTGTGTTAAGTTTTTCATCTGTGCATCAAATCACAAAAAGAATAAAT
AGAGCTTTTTCCTTTATCAGTCCCTTGGGCACAGCAGGTCCTGAACACCCTGCTCTACAA
TGTTGCATCAAGAGTTCAAACAACAAAATAAAAAATATTAAGAGGAAATCCCCATCCTGT
GACTTGAGTCCCTTAAGTCTACAGGGGCTGGTGACCTCTTTTTGCTAATAGGAAAATCAC
ATTACTACAAAATGGGGAGAAAACTGTTTGCCTGTGGTAGACACCTGCACGCATAGGATT
GAAGACAGTACAGGCTGCTGTACAGAGAAGCGCCTCTCACATCTGAACTGCATACTGAGC
GGGCAAGTCGGTTGTAAGTTCAGTAAAACCCTCTGATGATGCAAAAAAAAAAAAAAAAGT
ATTAAGTTTCACAAGCTGTTTGTACTCAAATATATTTTCTCAGTTTCAGATCCTCTGCTA
TTTTATTGAGTGGAAAGTCTTGAGCTAAAAGGGTTCAAGAAGAATAATGTTGCATTTCCT
TATGTCTCAGGAAACACTTTTTATGGTAACTTGTCAGATTGTCTATGAACAAACCCACTT
TTTTAGACATTGATAAAGTCTTCTTTTCTTCACGTGATATTTTATACAAGAACACTTCAG
ATGTATTAGATGTGACTGATTTTAACAAATCCTATTAGATTTGTATCAACTAGTTACATG
TTCTATTCATAGTCTTTTGTGAATCATTGCCTTTTTGTTTAAAAAGATGGCCTATTTTGA
GCCTTTGTATAGGTACATTCCTGTTTTTGTGACAAAAGAAAAACTTTAAAATTGTCCCAA
ACAGAAAAATAATGGCTATCAGAAGTATGTTTTGTTTTAGTGTGAGTTACCGTTACTGTA
TTTGTTTATTGTAAAGGTGGACATTTAGCGTTCAGTGCAGTTTTCAATAAAAAGTAATTA
AAATTTGTTAAGTTCTGAAATTCAAGTACATCTCACTAATGTAAATGTTCTCTACTTGAG
ATGTTTAAGGCAATTGCATTGTCAATTAGCCAATTTCCAGCTCTTGTTACTACAGGGTTC
CATAACCAGACTCAAGACCGCTGACAATTAATTACCTGTGATAACAAAAAGTTTAATTGA
AAAATCAAAACCTCACACAAGTCCATCATTATCACGTCATGCCATCCTTAAGATGCAATG
GTGGGTTAGTGCTAAATCAATTCAAAAAAAAACAAAGTTGCTCAACTTTTAGAGTTCTGA
CTTTAATCTACCCCAAAGCAAAATGACCTGGACCTGGTTCAAGGGAGGGAAGTGAACCTT
GAAACTGTTTTGCCAATAACCTAACAAACAAAATGATATTTACAAAGAAGTGTTGCAAAT
AGTCCCATGAGTTAAGAGCTTGATTTAATGGATCTTCTTTTTAAATAGAATTAAACCTTT
ATACTAAAAGTA

Protein Sequence

>1488 : length: 985
MPVPSRHINIGRSQSWDAAGWYEGPWENAESLRPLGRRSSLTYGTAEGTWFEPNHRPQDA
ALPVAAEPYLYREAVYNSVAARKGSTPDFTFYDSRQAVMSGRSPLLPREYYSDPSGAARV
PKEPPLYRDPGVSRPVPSYGVLGSRTSWDPMQGRSPALQDAGHLYRDPGGKMIPQGRQTQ
SRAASPGRYGREQPDTRYGAEVPAYPLSQVFSDISERPIDPAPARQVAPTCLVVDPSSAA
APEGSTGVAPGALNRGYGPARESIPSKMAYETYEADLSTFQGPGGKRTVLPEFLAFLRAE
GLAEATLGALLQQGFDSPAVLATLEDADIKSVAPNLGQARVLSRLANSCRTEMQLRRQDR
GGPLPRARSSSFSHRSELLHGDLASLGAAAPLQTASPRAGDPARRPSSAPSQHLLETAAT
YSAPGVGTHAPHFPSNSGYSSPTPCALTARLSPTYPLQAGVALTNPGPSNPLHPGPRTAY
STAYTVPMELLKRERNVAASPLPSPHGSPQVLRKPGAPLGPSTLPPASQSLHTPHSPYQK
VARRTGAPIIVSTMLAPEPSIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFC
DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG
IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRG
ETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVS
LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES
EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE
FFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV
AHPSQAPSPNQPTKHGDNREHPNEQ