ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1459

Name

CSNK2A2

Synonym

CK2A2|CSNK2A1;casein kinase 2, alpha prime polypeptide;CSNK2A2;casein kinase 2, alpha prime polypeptide

Definition

CK II alpha'|casein kinase II subunit alpha'

Position

16q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Tight junction;KEGG PATHWAY;hsa04530

External Links

Links to cell senescence gene database

1459

Links to epithelial mesenchymal transition gene database

1459

Links to ovarian cancer gene database

1459

Links to endometrial cancer gene database

1459

Links to iHOP

1459

Sequence Information

Nucleotide Sequence

>1459 : length: 1674
GCGGCCGCCCGCCGCCGCGCTCCTCCTCCTCCTCCTCCAGCGCCCGGCGGCCCGCTGCCT
CCTCCGCCCGACGCCCCGCGTCCCCCGCCGCGCCGCCGCCGCCACCCTCTGCGCCCCGCG
CCGCCCCCCGGTCCCGCCCGCCATGCCCGGCCCGGCCGCGGGCAGCAGGGCCCGGGTCTA
CGCCGAGGTGAACAGTCTGAGGAGCCGCGAGTACTGGGACTACGAGGCTCACGTCCCGAG
CTGGGGTAATCAAGATGATTACCAACTGGTTCGAAAACTTGGTCGGGGAAAATATAGTGA
AGTATTTGAGGCCATTAATATCACCAACAATGAGAGAGTGGTTGTAAAAATCCTGAAGCC
AGTGAAGAAAAAGAAGATAAAACGAGAGGTTAAGATTCTGGAGAACCTTCGTGGTGGAAC
AAATATCATTAAGCTGATTGACACTGTAAAGGACCCCGTGTCAAAGACACCAGCTTTGGT
ATTTGAATATATCAATAATACAGATTTTAAGCAACTCTACCAGATCCTGACAGACTTTGA
TATCCGGTTTTATATGTATGAACTACTTAAAGCTCTGGATTACTGCCACAGCAAGGGAAT
CATGCACAGGGATGTGAAACCTCACAATGTCATGATAGATCACCAACAGAAAAAGCTGCG
ACTGATAGATTGGGGTCTGGCAGAATTCTATCATCCTGCTCAGGAGTACAATGTTCGTGT
AGCCTCAAGGTACTTCAAGGGACCAGAGCTCCTCGTGGACTATCAGATGTATGATTATAG
CTTGGACATGTGGAGTTTGGGCTGTATGTTAGCAAGCATGATCTTTCGAAGGGAACCATT
CTTCCATGGACAGGACAACTATGACCAGCTTGTTCGCATTGCCAAGGTTCTGGGTACAGA
AGAACTGTATGGGTATCTGAAGAAGTATCACATAGACCTAGATCCACACTTCAACGATAT
CCTGGGACAACATTCACGGAAACGCTGGGAAAACTTTATCCATAGTGAGAACAGACACCT
TGTCAGCCCTGAGGCCCTAGATCTTCTGGACAAACTTCTGCGATACGACCATCAACAGAG
ACTGACTGCCAAAGAGGCCATGGAGCACCCATACTTCTACCCTGTGGTGAAGGAGCAGTC
CCAGCCTTGTGCAGACAATGCTGTGCTTTCCAGTGGTCTCACGGCAGCACGATGAAGACT
GGAAAGCGACGGGTCTGTTGCGGTTCTCCCACTTTTCCATAAGCAGAACAAGAACCAAAT
CAAACGTCTTAACGCGTATAGAGAGATCACGTTCCGTGAGCAGACACAAAACGGTGGCAG
GTTTGGCGAGCACGAACTAGACCAAGCGAAGGGCAGCCCACCACCGTATATCAAACCTCA
CTTCCGAATGTAAAAGGCTCACTTGCCTTTGGCTTCCTGTTGACTTCTTCCCGACCCAGA
AAGCATGGGGAATGTGAAGGGTATGCAGAATGTTGTTGGTTACTGTTGCTCCCCGAGCCC
CTCAACTCGTCCCGTGGCCGCCTGTTTTTCCAGCAAACCACGCTAACTAGCTGACCACAG
ACTCCACAGTGGGGGGACGGGCGCAGTATGTGGCATGGCGGCAGTTACATATTATTATTT
TAAAAGTATATATTATTGAATAAAAGGTTTTAAAAGAAAAAAAAAAAAAAAAAA

Protein Sequence

>1459 : length: 350
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNY
DQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR