ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1457

Name

CSNK2A1

Synonym

CK2A1|CKII|CSNK2A3;casein kinase 2, alpha 1 polypeptide;CSNK2A1;casein kinase 2, alpha 1 polypeptide

Definition

CK II alpha 3|CK2 catalytic subunit alpha|casein kinase II alpha 1 polypeptide pseudogene|casein kinase II alpha 1 subunit|casein kinase II subunit alpha|protein kinase CK2

Position

20p13

Gene Type

protein-coding

Pathways and Diseases

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Pathway

Alpha-synuclein signaling;PID Curated;200187

Pathway

pdgf signaling pathway;PID BioCarta;100077

Pathway

segmentation clock;PID BioCarta;100146

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

PDGFR-alpha signaling pathway;PID Curated;200140

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

igf-1 signaling pathway;PID BioCarta;100136

Pathway

calcium signaling by hbx of hepatitis b virus;PID BioCarta;100150

Pathway

Parkinson disease;PANTHER;P00049

Pathway

Lissencephaly gene (LIS1) in neuronal migration and development;PID Curated;200114

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

lissencephaly gene (lis1) in neuronal migration and development;PID BioCarta;100116

Pathway

bcr signaling pathway;PID BioCarta;100227

Pathway

nerve growth factor pathway (ngf);PID BioCarta;100096

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

tpo signaling pathway;PID BioCarta;100012

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Disease

Breast cancer;FunDO

Disease

Infection;FunDO

External Links

Links to cell senescence gene database

1457

Links to epithelial mesenchymal transition gene database

1457

Links to ovarian cancer gene database

1457

Links to endometrial cancer gene database

1457

Links to iHOP

1457

Sequence Information

Nucleotide Sequence

>1457 : length: 4343
AGCCTCGCTCTGGTCCCTGCGGCTGGCGGCCGAGCCGTGTGTCTCCTCCTCCATCGCCGC
CATATTGTCTGTGTGAGCAGAGGGGAGAGCGGCCGCCGCCGCTGCCGCTTCCACCACAGT
TTGAAGAAAACAGGTCTGAAACAAGGTCTTACCCCCAGCTGCTTCTGAACACAGTGACTG
CCAGATCTCCAAACATCAAGTCCAGCTTTGTCCGCCAACCTGTCTGACATGTCGGGACCC
GTGCCAAGCAGGGCCAGAGTTTACACAGATGTTAATACACACAGACCTCGAGAATACTGG
GATTACGAGTCACATGTGGTGGAATGGGGAAATCAAGATGACTACCAGCTGGTTCGAAAA
TTAGGCCGAGGTAAATACAGTGAAGTATTTGAAGCCATCAACATCACAAATAATGAAAAA
GTTGTTGTTAAAATTCTCAAGTACCTGCAGAATACCTGGCACAGTGCTAGGAGAAGGATT
CAGAGACGAATGTGACACATTTTCTTCCTTCAAGGTGTGCTCATAACCAGTAAAAAAGAA
GAAAATTAAGCGTGAAATAAAGATTTTGGAGAATTTGAGAGGAGGTCCCAACATCATCAC
ACTGGCAGACATTGTAAAAGACCCTGTGTCACGAACCCCCGCCTTGGTTTTTGAACACGT
AAACAACACAGACTTCAAGCAATTGTACCAGACGTTAACAGACTATGATATTCGATTTTA
CATGTATGAGATTCTGAAGGCCCTGGATTATTGTCACAGCATGGGAATTATGCACAGAGA
TGTCAAGCCCCATAATGTCATGATTGATCATGAGCACAGAAAGCTACGACTAATAGACTG
GGGTTTGGCTGAGTTTTATCATCCTGGCCAAGAATATAATGTCCGAGTTGCTTCCCGATA
CTTCAAAGGTCCTGAGCTACTTGTAGACTATCAGATGTACGATTATAGTTTGGATATGTG
GAGTTTGGGTTGTATGCTGGCAAGTATGATCTTTCGGAAGGAGCCATTTTTCCATGGACA
TGACAATTATGATCAGTTGGTGAGGATAGCCAAGGTTCTGGGGACAGAAGATTTATATGA
CTATATTGACAAATACAACATTGAATTAGATCCACGTTTCAATGATATCTTGGGCAGACA
CTCTCGAAAGCGATGGGAACGCTTTGTCCACAGTGAAAATCAGCACCTTGTCAGCCCTGA
GGCCTTGGATTTCCTGGACAAACTGCTGCGATATGACCACCAGTCACGGCTTACTGCAAG
AGAGGCAATGGAGCACCCCTATTTCTACACTGTTGTGAAGGACCAGGCTCGAATGGGTTC
ATCTAGCATGCCAGGGGGCAGTACGCCCGTCAGCAGCGCCAATATGATGTCAGGGATTTC
TTCAGTGCCAACCCCTTCACCCCTTGGACCTCTGGCAGGCTCACCAGTGATTGCTGCTGC
CAACCCCCTTGGGATGCCTGTTCCAGCTGCCGCTGGCGCTCAGCAGTAACGGCCCTATCT
GTCTCCTGATGCCTGAGCAGAGGTGGGGGAGTCCACCCTCTCCTTGATGCAGCTTGCGCC
TGGCGGGGAGGGGTGAAACACTTCAGAAGCACCGTGTCTGAACCGTTGCTTGTGGATTTA
TAGTAGTTCAGTCATAAAAAAAAAATTATAATAGGCTGATTTTCTTTTTTCTTTTTTTTT
TTAACTCGAACTTTTCATAACTCAGGGGATTCCCTGAAAAATTACCTGCAGGTGGAATAT
TTCATGGACAAATTTTTTTTTCTCCCCTCCCAAATTTAGTTCCTCATCACAAAAGAACAA
AGATAAACCAGCCTCAATCCCGGCTGCTGCATTTAGGTGGAGACTTCTTCCCATTCCCAC
CATTGTTCCTCCACCGTCCCACACTTTAGGGGGTTGGTATCTCGTGCTCTTCTCCAGAGA
TTACAAAAATGTAGCTTCTCAGGGGAGGCAGGAAGAAAGGAAGGAAGGAAAGAAGGAAGG
GAGGACCCAATCTATAGGAGCAGTGGACTGCTTGCTGGTCGCTTACATCACTTTACTCCA
TAAGCGCTTCAGTGGGGTTATCCTAGTGGCTCTTGTGGAAGTGTGTCTTAGTTACATCAA
GATGTTGAAAATCTACCCAAAATGCAGACAGATACTAAAAACTTCTGTTCAGTAAGAATC
ATGTCTTACTGATCTAACCCTAAATCCAACTCATTTATACTTTTATTTTTAGTTCAGTTT
AAAATGTTGATACCTTCCCTCCCAGGCTCCTTACCTTGGTCTTTTCCCTGTTCATCTCCC
AACATGCTGTGCTCCATAGCTGGTAGGAGAGGGAAGGCAAAATCTTTCTTAGTTTTCTTT
GTCTTGGCCATTTTGAATTCATTTAGTTACTGGGCATAACTTACTGCTTTTTACAAAAGA
AACAAACATTGTCTGTACAGGTTTCATGCTAGAGCTAATGGGAGATGTGGCCACACTGAC
TTCCATTTTAAGCTTTCTACCTTCTTTTCCTCCGACCGTCCCCTTCCCTCACATGCCATC
CAGTGAGAAGACCTGCTCCTCAGTCTTGTAAATGTATCTTGAGAGGTAGGAGCAGAGCCA
CTATCTCCATTGAAGCTGAAATGGTAGACCTGTAATTGTGGGAAAACTATAAACTCTCTT
GTTACAGCCCCGCCACCCCTTGCTGTGTGTATATATATAATACTTTGTCCTTCATATGTG
AAAGATCCAGTGTTGGAATTCTTTGGTGTAAATAAACGTTTGGTTTTATTTATCAAGGTT
AGATTTAAGTTCCCTGTGTAAAGGTCTTGCTGGGTGGGTGTCTCATGTTCACATCTGAGG
GGCCTGCAGCCCTGTACCGTGGAGGCTTCCCAAGGCCCCCATTTTATACACCCCTCGTTC
GACCCATGGTACCGGGCAGAGCAGAGAGGCCTTAAAAAAAAAGCACCACAAGCCAAAGCG
TCTCTGGGGATTAAGGATCCTTTGCCATAAAACTCATTTTGTGTCTCAGCAGTGCAGGGA
TTGGGGATGGAAAAAGTCGCCAGTTTTTGTGTGTTTGTGTGTGTGTGTAAAGTGGACTTT
CCACTGTAATCCAACCACCTAAGTTTATCAGGTGCTTCACTGAGGAAGCCTAGTTTTTTA
AGCACAATAGCAAAACCATCAGCTCTGTATTTTCTCCTGTTATTTCATTACAGTAGCTGC
TTGTGGGAACTAGGAAAAATTCTTCCAACATATTTTAAGGCCTAAAATCTTAGTTCCCCA
TTCTCCTACCTTATAGATTCACAGGCCTTTCTCGCCTAGGCATCATAGATAAACGTAATT
GTTTGGGGAGTTGAATTTAATGAACTTATCTAACTTTGTAACCCATCTTGGCTTTAGTAA
CTTTATCAAGGTGGTGGCTTTAGTGAATATAATGGTAAACTTTAGAGGACGCTAAAGCCT
CCTTTTATAGCGCTTCTCAACGGTAGGGAGAGCTGAAGGGAAAACATTCTGACTGTGTGG
CAGGGTGATTTTCTTCCTTATGACCACTTACAGTGGATATTTATTGTACTTGACCCTTTT
ATGCCCTAGAATGCTGTGAGGGTTACCATGTTGAATTTGTGCAGAAGCTAAAAGCACCAG
ATGTGCCAGAGATGCAATTTGTGATTATGTTTGCACTGGATTGTGATTTGAACAGGACAC
TTATAACTAATGAGTTCTTTCTTTTGAGGTGGGGAGAGGGTTGTAAATCAAGACTTCATA
CCCTATCCTTGTAGCTCGGAAATTGAGGTGTAGCTTAGGCTGATGCGGAGAGCTGCAGAC
AGCTGGACCTCCTTACACCCATCAGACCTTGGAATAAACCGAAGGTGAATGCAGAGGACT
CTGAGGTGCCACCCAAGAGCCTTTTAAAATAAATAGAAGTTTTTAAAAATGCTACTTAAG
AGTCACTGCAGAAGCATGGAGAGAGAGAAAAAAAAAAAAGACCCAATTGGGTGGGGGGTG
GGGGGGAGGCAAGGGTTTACAGAGTAACAACTTACGTGTTGTTGTAAATTACCTCATCTG
TATACCTTGTATTGGGACACTATTTCTCAGCACTACCTGTGTCTGCATTGCTTAGATGGC
AGGAAATGGAATGGCCAACATGAAAGGTTATGTTGGCAATTACTCTGAAAGATTTTTTAA
AGTATTTTTAAACTTTGTTTGAAGTGGTCCCTCCCCTCTTCCTCTGCTTTTTTTTAAGTT
TGAAGCCAGAAGGCCCTCCCCACCTTGCTTTATTGGTTGTAATTGTATTGTAATTGGTAT
GACTAAACCATAACTGTGCTGGGAAGAAGTTGTGCCATGAAGGTCTTTAATTTTTTTTAA
TAAAAACATTTAAATAAATGAAA

Protein Sequence

>1457 : length: 391
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ