ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1441

Name

CSF3R

Synonym

CD114|GCSFR;colony stimulating factor 3 receptor (granulocyte);CSF3R;colony stimulating factor 3 receptor (granulocyte)

Definition

CD114 antigen|G-CSF receptor|G-CSF-R|granulocyte colony-stimulating factor receptor

Position

1p35-p34.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Disease

Embryoma;FunDO

Disease

Bladder cancer;FunDO

Disease

Leukemia;FunDO

Disease

Congenital abnormality;FunDO

Disease

Neutropenia;FunDO

Disease

Neutrophilia, hereditary;OMIM

External Links

Links to cell senescence gene database

1441

Links to epithelial mesenchymal transition gene database

1441

Links to ovarian cancer gene database

1441

Links to endometrial cancer gene database

1441

Links to iHOP

1441

Sequence Information

Nucleotide Sequence

>1441 : length: 3500
GAGTACTGTGAAGATGTGGTCCCCAAGGCTAGAGCTGAAAAGAGGCTTAGGGCCGGGTGA
GCCTTCCAGCCAGGGCCTGCCTCCAAGTGATGCTCCCCCAGGGCAGGGGGCATAAGGATG
GCACCCAGCCAGGTGGGAGCCTGGGCCCTGCCCAGCCTCAAAGCTTTGAGCTCAGGAAAT
CCGGAGGCAGGGGAGGGGGACATCGTTGCCACATTCCCCAGCCCTTTAAGACCCCCAAGG
CAGGAAGGCTGCCCGGGCCTCACCAGCTTCCCTCACAGGCTCCTTCCTGGGAGGAAGGGG
CTGCCTGTGCCCTCGAAGGCGCAAGGGAGGGCAGGAGGGAGGCTCGGAAGGTGTTGCAAT
CCCCAGCCCCCGGGCCTGTCAGAGGCTGAGCCATTAACGACAGAGCTCGGGGAGAGAAGC
TGGACTGCAGCTGGTTTCAGGAACTTCTCTTGACGAGAAGAGAGACCAAGGAGGCCAAGC
AGGGGCTGGGCCAGAGGTGCCAACATGGGGAAACTGAGGCTCGGCTCGGAAAGGTGAAGT
AACTTGTCCAAGATCACAAAGCTGGTGAACATCAAGTTGGTGCTATGGCAAGGCTGGGAA
ACTGCAGCCTGACTTGGGCTGCCCTGATCATCCTGCTGCTCCCCGGAAGTCTGGAGGAGT
GCGGGCACATCAGTGTCTCAGCCCCCATCGTCCACCTGGGGGATCCCATCACAGCCTCCT
GCATCATCAAGCAGAACTGCAGCCATCTGGACCCGGAGCCACAGATTCTGTGGAGACTGG
GAGCAGAGCTTCAGCCCGGGGGCAGGCAGCAGCGTCTGTCTGATGGGACCCAGGAATCTA
TCATCACCCTGCCCCACCTCAACCACACTCAGGCCTTTCTCTCCTGCTGCCTGAACTGGG
GCAACAGCCTGCAGATCCTGGACCAGGTTGAGCTGCGCGCAGGCTACCCTCCAGCCATAC
CCCACAACCTCTCCTGCCTCATGAACCTCACAACCAGCAGCCTCATCTGCCAGTGGGAGC
CAGGACCTGAGACCCACCTACCCACCAGCTTCACTCTGAAGAGTTTCAAGAGCCGGGGCA
ACTGTCAGACCCAAGGGGACTCCATCCTGGACTGCGTGCCCAAGGACGGGCAGAGCCACT
GCTGCATCCCACGCAAACACCTGCTGTTGTACCAGAATATGGGCATCTGGGTGCAGGCAG
AGAATGCGCTGGGGACCAGCATGTCCCCACAACTGTGTCTTGATCCCATGGATGTTGTGA
AACTGGAGCCCCCCATGCTGCGGACCATGGACCCCAGCCCTGAAGCGGCCCCTCCCCAGG
CAGGCTGCCTACAGCTGTGCTGGGAGCCATGGCAGCCAGGCCTGCACATAAATCAGAAGT
GTGAGCTGCGCCACAAGCCGCAGCGTGGAGAAGCCAGCTGGGCACTGGTGGGCCCCCTCC
CCTTGGAGGCCCTTCAGTATGAGCTCTGCGGGCTCCTCCCAGCCACGGCCTACACCCTGC
AGATACGCTGCATCCGCTGGCCCCTGCCTGGCCACTGGAGCGACTGGAGCCCCAGCCTGG
AGCTGAGAACTACCGAACGGGCCCCCACTGTCAGACTGGACACATGGTGGCGGCAGAGGC
AGCTGGACCCCAGGACAGTGCAGCTGTTCTGGAAGCCAGTGCCCCTGGAGGAAGACAGCG
GACGGATCCAAGGTTATGTGGTTTCTTGGAGACCCTCAGGCCAGGCTGGGGCCATCCTGC
CCCTCTGCAACACCACAGAGCTCAGCTGCACCTTCCACCTGCCTTCAGAAGCCCAGGAGG
TGGCCCTTGTGGCCTATAACTCAGCCGGGACCTCTCGTCCCACTCCGGTGGTCTTCTCAG
AAAGCAGAGGCCCAGCTCTGACCAGACTCCATGCCATGGCCCGAGACCCTCACAGCCTCT
GGGTAGGCTGGGAGCCCCCCAATCCATGGCCTCAGGGCTATGTGATTGAGTGGGGCCTGG
GCCCCCCCAGCGCGAGCAATAGCAACAAGACCTGGAGGATGGAACAGAATGGGAGAGCCA
CGGGGTTTCTGCTGAAGGAGAACATCAGGCCCTTTCAGCTCTATGAGATCATCGTGACTC
CCTTGTACCAGGACACCATGGGACCCTCCCAGCATGTCTATGCCTACTCTCAAGAAATGG
CTCCCTCCCATGCCCCAGAGCTGCATCTAAAGCACATTGGCAAGACCTGGGCACAGCTGG
AGTGGGTGCCTGAGCCCCCTGAGCTGGGGAAGAGCCCCCTTACCCACTACACCATCTTCT
GGACCAACGCTCAGAACCAGTCCTTCTCCGCCATCCTGAATGCCTCCTCCCGTGGCTTTG
TCCTCCATGGCCTGGAGCCCGCCAGTCTGTATCACATCCACCTCATGGCTGCCAGCCAGG
CTGGGGCCACCAACAGTACAGTCCTCACCCTGATGACCTTGACCCCAGAGGGGTCGGAGC
TACACATCATCCTGGGCCTGTTCGGCCTCCTGCTGTTGCTCACCTGCCTCTGTGGAACTG
CCTGGCTCTGTTGCAGCCCCAACAGGAAGAATCCCCTCTGGCCAAGTGTCCCAGACCCAG
CTCACAGCAGCCTGGGCTCCTGGGTGCCCACAATCATGGAGGAGCTGCCCGGACCCAGAC
AGGGACAGTGGCTGGGGCAGACATCTGAAATGAGCCGTGCTCTCACCCCACATCCTTGTG
TGCAGGATGCCTTCCAGCTGCCCGGCCTTGGCACGCCACCCATCACCAAGCTCACAGTGC
TGGAGGAGGATGAAAAGAAGCCGGTGCCCTGGGAGTCCCATAACAGCTCAGAGACCTGTG
GCCTCCCCACTCTGGTCCAGACCTATGTGCTCCAGGGGGACCCAAGAGCAGTTTCCACCC
AGCCCCAATCCCAGTCTGGCACCAGCGATCAGGTCCTTTATGGGCAGCTGCTGGGCAGCC
CCACAAGCCCAGGGCCAGGGCACTATCTCCGCTGTGACTCCACTCAGCCCCTCTTGGCGG
GCCTCACCCCCAGCCCCAAGTCCTATGAGAACCTCTGGTTCCAGGCCAGCCCCTTGGGGA
CCCTGGTAACCCCAGCCCCAAGCCAGGAGGACGACTGTGTCTTTGGGCCACTGCTCAACT
TCCCCCTCCTGCAGGGGATCCGGGTCCATGGGATGGAGGCGCTGGGGAGCTTCTAGGGCT
TCCTGGGGTTCCCTTCTTGGGCCTGCCTCTTAAAGGCCTGAGCTAGCTGGAGAAGAGGGG
AGGGTCCATAAGCCCATGACTAAAAACTACCCCAGCCCAGGCTCTCACCATCTCCAGTCA
CCAGCATCTCCCTCTCCTCCCAATCTCCATAGGCTGGGCCTCCCAGGCGATCTGCATACT
TTAAGGACCAGATCATGCTCCATCCAGCCCCACCCAATGGCCTTTTGTGCTTGTTTCCTA
TAACTTCAGTATTGTAAACTAGTTTTTGGTTTGCAGTTTTTGTTGTTGTTTATAGACACT
CTTGGGTGTAAAAAAAAAAA

Protein Sequence

>1441 : length: 863
MARLGNCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQ
ILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAG
YPPAIPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPK
DGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPMLRTMDPSPE
AAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALQYELCGLLPA
TAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQLDPRTVQLFWKPVP
LEEDSGRIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPT
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRME
QNGRATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGK
TWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHL
MAASQAGATNSTVLTLMTLTPEGSELHIILGLFGLLLLLTCLCGTAWLCCSPNRKNPLWP
SVPDPAHSSLGSWVPTIMEELPGPRQGQWLGQTSEMSRALTPHPCVQDAFQLPGLGTPPI
TKLTVLEEDEKKPVPWESHNSSETCGLPTLVQTYVLQGDPRAVSTQPQSQSGTSDQVLYG
QLLGSPTSPGPGHYLRCDSTQPLLAGLTPSPKSYENLWFQASPLGTLVTPAPSQEDDCVF
GPLLNFPLLQGIRVHGMEALGSF