ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1440

Name

CSF3

Synonym

C17orf33|CSF3OS|GCSF;colony stimulating factor 3 (granulocyte);CSF3;colony stimulating factor 3 (granulocyte)

Definition

filgrastim|granulocyte colony-stimulating factor|granulocyte-colony stimulating factor|lenograstim|pluripoietin

Position

17q11.2-q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Disease

Ischemia;FunDO

Disease

Embryoma;FunDO

Disease

Diabetes mellitus;FunDO

Disease

HEMATOLOGICAL;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Bladder cancer;FunDO

Disease

Lung cancer;FunDO

Disease

Leukemia;FunDO

Disease

Systemic infection;FunDO

Disease

Neutropenia;FunDO

Disease

vascular disease;GAD

Disease

Cervical cancer;FunDO

Disease

neutrophil count;GAD

External Links

Links to cell senescence gene database

1440

Links to epithelial mesenchymal transition gene database

1440

Links to ovarian cancer gene database

1440

Links to endometrial cancer gene database

1440

Links to iHOP

1440

Sequence Information

Nucleotide Sequence

>1440 : length: 1769
AGTCGTGGCCCCAGGTAATTTCCTCCCAGGCCTCCATGGGGTTATGTATAAAGGCCCCCC
TAGAGCTGGGCCCCAAAACAGCCCGGAGCCTGCAGCCCAGCCCCACCCAGACCCATGGCT
GGACCTGCCACCCAGAGCCCCATGAAGCTGATGGGTGAGTGTCTTGGCCCAGGATGGGAG
AGCCGCCTGCCCTGGCATGGGAGGGAGGCTGGTGTGACAGAGGGGCTGGGGATCCCCGTT
CTGGGAATGGGGATTAAAGGCACCCAGTGTCCCCGAGAGGGCCTCAGGTGGTAGGGAACA
GCATGTCTCCTGAGCCCGCTCTGTCCCCAGCCCTGCAGCTGCTGCTGTGGCACAGTGCAC
TCTGGACAGTGCAGGAAGCCACCCCCCTGGGCCCTGCCAGCTCCCTGCCCCAGAGCTTCC
TGCTCAAGTGCTTAGAGCAAGTGAGGAAGATCCAGGGCGATGGCGCAGCGCTCCAGGAGA
AGCTGTGTGCCACCTACAAGCTGTGCCACCCCGAGGAGCTGGTGCTGCTCGGACACTCTC
TGGGCATCCCCTGGGCTCCCCTGAGCAGCTGCCCCAGCCAGGCCCTGCAGCTGGCAGGCT
GCTTGAGCCAACTCCATAGCGGCCTTTTCCTCTACCAGGGGCTCCTGCAGGCCCTGGAAG
GGATCTCCCCCGAGTTGGGTCCCACCTTGGACACACTGCAGCTGGACGTCGCCGACTTTG
CCACCACCATCTGGCAGCAGATGGAAGAACTGGGAATGGCCCCTGCCCTGCAGCCCACCC
AGGGTGCCATGCCGGCCTTCGCCTCTGCTTTCCAGCGCCGGGCAGGAGGGGTCCTGGTTG
CCTCCCATCTGCAGAGCTTCCTGGAGGTGTCGTACCGCGTTCTACGCCACCTTGCCCAGC
CCTGAGCCAAGCCCTCCCCATCCCATGTATTTATCTCTATTTAATATTTATGTCTATTTA
AGCCTCATATTTAAAGACAGGGAAGAGCAGAACGGAGCCCCAGGCCTCTGTGTCCTTCCC
TGCATTTCTGAGTTTCATTCTCCTGCCTGTAGCAGTGAGAAAAAGCTCCTGTCCTCCCAT
CCCCTGGACTGGGAGGTAGATAGGTAAATACCAAGTATTTATTACTATGACTGCTCCCCA
GCCCTGGCTCTGCAATGGGCACTGGGATGAGCCGCTGTGAGCCCCTGGTCCTGAGGGTCC
CCACCTGGGACCCTTGAGAGTATCAGGTCTCCCACGTGGGAGACAAGAAATCCCTGTTTA
ATATTTAAACAGCAGTGTTCCCCATCTGGGTCCTTGCACCCCTCACTCTGGCCTCAGCCG
ACTGCACAGCGGCCCCTGCATCCCCTTGGCTGTGAGGCCCCTGGACAAGCAGAGGTGGCC
AGAGCTGGGAGGCATGGCCCTGGGGTCCCACGAATTTGCTGGGGAATCTCGTTTTTCTTC
TTAAGACTTTTGGGACATGGTTTGACTCCCGAACATCACCGACGCGTCTCCTGTTTTTCT
GGGTGGCCTCGGGACACCTGCCCTGCCCCCACGAGGGTCAGGACTGTGACTCTTTTTAGG
GCCAGGCAGGTGCCTGGACATTTGCCTTGCTGGACGGGGACTGGGGATGTGGGAGGGAGC
AGACAGGAGGAATCATGTCAGGCCTGTGTGTGAAAGGAAGCTCCACTGTCACCCTCCACC
TCTTCACCCCCCACTCACCAGTGTCCCCTCCACTGTCACATTGTAACTGAACTTCAGGAT
AATAAAGTGTTTGCCTCCAAAAAAAAAAA

Protein Sequence

>1440 : length: 207
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP