ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1436

Name

CSF1R

Synonym

C-FMS|CD115|CSF-1R|CSFR|FIM2|FMS|HDLS|M-CSF-R;colony stimulating factor 1 receptor;CSF1R;colony stimulating factor 1 receptor

Definition

CD115 antigen|CSF-1 receptor|FMS proto-oncogene|McDonough feline sarcoma viral (v-fms) oncogene homolog|macrophage colony stimulating factor I receptor|macrophage colony-stimulating factor 1 receptor|proto-oncogene c-Fms

Position

5q32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

mets affect on macrophage differentiation;PID BioCarta;100169

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Integrins in angiogenesis;PID Curated;200109

Disease

Cancers;KEGG DISEASE

Disease

Prostate cancer;FunDO

Disease

Enteritis;FunDO

Disease

IMMUNE;GAD

Disease

Leukemia;FunDO

Disease

Choriocarcinoma;KEGG DISEASE;H00028

Disease

Crohn's disease;GAD

Disease

Myeloid malignancy, predisposition to;OMIM

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Breast cancer;FunDO

Disease

Leukoencephalopathy;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

1436

Links to epithelial mesenchymal transition gene database

1436

Links to ovarian cancer gene database

1436

Links to endometrial cancer gene database

1436

Links to iHOP

1436

Sequence Information

Nucleotide Sequence

>1436 : length: 4006
GAAGGGCAGACAGAGTGTCCAAAAGCGTGAGAGCACGAAGTGAGGAGAAGGTGGAGAAGA
GAGAAGAGGAAGAGGAAGAGGAAGAGAGGAAGCGGAGGGAACTGCGGCCAGGCTAAAAGG
GGAAGAAGAGGATCAGCCCAAGGAGGAGGAAGAGGAAAACAAGACAAACAGCCAGTGCAG
AGGAGAGGAACGTGTGTCCAGTGTCCCGATCCCTGCGGAGCTAGTAGCTGAGAGCTCTGT
GCCCTGGGCACCTTGCAGCCCTGCACCTGCCTGCCACTTCCCCACCGAGGCCATGGGCCC
AGGAGTTCTGCTGCTCCTGCTGGTGGCCACAGCTTGGCATGGTCAGGGAATCCCAGTGAT
AGAGCCCAGTGTCCCTGAGCTGGTCGTGAAGCCAGGAGCAACGGTGACCTTGCGATGTGT
GGGCAATGGCAGCGTGGAATGGGATGGCCCCCCATCACCTCACTGGACCCTGTACTCTGA
TGGCTCCAGCAGCATCCTCAGCACCAACAACGCTACCTTCCAAAACACGGGGACCTATCG
CTGCACTGAGCCTGGAGACCCCCTGGGAGGCAGCGCCGCCATCCACCTCTATGTCAAAGA
CCCTGCCCGGCCCTGGAACGTGCTAGCACAGGAGGTGGTCGTGTTCGAGGACCAGGACGC
ACTACTGCCCTGTCTGCTCACAGACCCGGTGCTGGAAGCAGGCGTCTCGCTGGTGCGTGT
GCGTGGCCGGCCCCTCATGCGCCACACCAACTACTCCTTCTCGCCCTGGCATGGCTTCAC
CATCCACAGGGCCAAGTTCATTCAGAGCCAGGACTATCAATGCAGTGCCCTGATGGGTGG
CAGGAAGGTGATGTCCATCAGCATCCGGCTGAAAGTGCAGAAAGTCATCCCAGGGCCCCC
AGCCTTGACACTGGTGCCTGCAGAGCTGGTGCGGATTCGAGGGGAGGCTGCCCAGATCGT
GTGCTCAGCCAGCAGCGTTGATGTTAACTTTGATGTCTTCCTCCAACACAACAACACCAA
GCTCGCAATCCCTCAACAATCTGACTTTCATAATAACCGTTACCAAAAAGTCCTGACCCT
CAACCTCGATCAAGTAGATTTCCAACATGCCGGCAACTACTCCTGCGTGGCCAGCAACGT
GCAGGGCAAGCACTCCACCTCCATGTTCTTCCGGGTGGTAGAGAGTGCCTACTTGAACTT
GAGCTCTGAGCAGAACCTCATCCAGGAGGTGACCGTGGGGGAGGGGCTCAACCTCAAAGT
CATGGTGGAGGCCTACCCAGGCCTGCAAGGTTTTAACTGGACCTACCTGGGACCCTTTTC
TGACCACCAGCCTGAGCCCAAGCTTGCTAATGCTACCACCAAGGACACATACAGGCACAC
CTTCACCCTCTCTCTGCCCCGCCTGAAGCCCTCTGAGGCTGGCCGCTACTCCTTCCTGGC
CAGAAACCCAGGAGGCTGGAGAGCTCTGACGTTTGAGCTCACCCTTCGATACCCCCCAGA
GGTAAGCGTCATATGGACATTCATCAACGGCTCTGGCACCCTTTTGTGTGCTGCCTCTGG
GTACCCCCAGCCCAACGTGACATGGCTGCAGTGCAGTGGCCACACTGATAGGTGTGATGA
GGCCCAAGTGCTGCAGGTCTGGGATGACCCATACCCTGAGGTCCTGAGCCAGGAGCCCTT
CCACAAGGTGACGGTGCAGAGCCTGCTGACTGTTGAGACCTTAGAGCACAACCAAACCTA
CGAGTGCAGGGCCCACAACAGCGTGGGGAGTGGCTCCTGGGCCTTCATACCCATCTCTGC
AGGAGCCCACACGCATCCCCCGGATGAGTTCCTCTTCACACCAGTGGTGGTCGCCTGCAT
GTCCATCATGGCCTTGCTGCTGCTGCTGCTCCTGCTGCTATTGTACAAGTATAAGCAGAA
GCCCAAGTACCAGGTCCGCTGGAAGATCATCGAGAGCTATGAGGGCAACAGTTATACTTT
CATCGACCCCACGCAGCTGCCTTACAACGAGAAGTGGGAGTTCCCCCGGAACAACCTGCA
GTTTGGTAAGACCCTCGGAGCTGGAGCCTTTGGGAAGGTGGTGGAGGCCACGGCCTTTGG
TCTGGGCAAGGAGGATGCTGTCCTGAAGGTGGCTGTGAAGATGCTGAAGTCCACGGCCCA
TGCTGATGAGAAGGAGGCCCTCATGTCCGAGCTGAAGATCATGAGCCACCTGGGCCAGCA
CGAGAACATCGTCAACCTTCTGGGAGCCTGTACCCATGGAGGCCCTGTACTGGTCATCAC
GGAGTACTGTTGCTATGGCGACCTGCTCAACTTTCTGCGAAGGAAGGCTGAGGCCATGCT
GGGACCCAGCCTGAGCCCCGGCCAGGACCCCGAGGGAGGCGTCGACTATAAGAACATCCA
CCTCGAGAAGAAATATGTCCGCAGGGACAGTGGCTTCTCCAGCCAGGGTGTGGACACCTA
TGTGGAGATGAGGCCTGTCTCCACTTCTTCAAATGACTCCTTCTCTGAGCAAGACCTGGA
CAAGGAGGATGGACGGCCCCTGGAGCTCCGGGACCTGCTTCACTTCTCCAGCCAAGTAGC
CCAGGGCATGGCCTTCCTCGCTTCCAAGAATTGCATCCACCGGGACGTGGCAGCGCGTAA
CGTGCTGTTGACCAATGGTCATGTGGCCAAGATTGGGGACTTCGGGCTGGCTAGGGACAT
CATGAATGACTCCAACTACATTGTCAAGGGCAATGCCCGCCTGCCTGTGAAGTGGATGGC
CCCAGAGAGCATCTTTGACTGTGTCTACACGGTTCAGAGCGACGTCTGGTCCTATGGCAT
CCTCCTCTGGGAGATCTTCTCACTTGGGCTGAATCCCTACCCTGGCATCCTGGTGAACAG
CAAGTTCTATAAACTGGTGAAGGATGGATACCAAATGGCCCAGCCTGCATTTGCCCCAAA
GAATATATACAGCATCATGCAGGCCTGCTGGGCCTTGGAGCCCACCCACAGACCCACCTT
CCAGCAGATCTGCTCCTTCCTTCAGGAGCAGGCCCAAGAGGACAGGAGAGAGCGGGACTA
TACCAATCTGCCGAGCAGCAGCAGAAGCGGTGGCAGCGGCAGCAGCAGCAGTGAGCTGGA
GGAGGAGAGCTCTAGTGAGCACCTGACCTGCTGCGAGCAAGGGGATATCGCCCAGCCCTT
GCTGCAGCCCAACAACTATCAGTTCTGCTGAGGAGTTGACGACAGGGAGTACCACTCTCC
CCTCCCACAAACTTCAACTCCTCCATGGATGGGGCGACACGGGGAGAACATACAAACTCT
GCCTTCGGTCATTTCACTCAACAGCTCGGCCCAGCTCTGAAACTTGGGAAGGTGAGGGAT
TCAGGGGAGGTCAGAGGATCCCACTTCCTGAGCATGGGCCATCACTGCCAGTCAGGGGCT
GGGGGCTGAGCCCTCACCCCCCCCTCCCCTACTGTTCTCATGGTGTTGGCCTCGTGTTTG
CTATGCCAACTAGTAGAACCTTCTTTCCTAATCCCCTTATCTTCATGGAAATGGACTGAC
TTTATGCCTATGAAGTCCCCAGGAGCTACACTGATACTGAGAAAACCAGGCTCTTTGGGG
CTAGACAGACTGGCAGAGAGTGAGATCTCCCTCTCTGAGAGGAGCAGCAGATGCTCACAG
ACCACACTCAGCTCAGGCCCCTTGGAGCAGGATGGCTCCTCTAAGAATCTCACAGGACCT
CTTAGTCTCTGCCCTATACGCCGCCTTCACTCCACAGCCTCACCCCTCCCACCCCCATAC
TGGTACTGCTGTAATGAGCCAAGTGGCAGCTAAAAGTTGGGGGTGTTCTGCCCAGTCCCG
TCATTCTGGGCTAGAAGGCAGGGGACCTTGGCATGTGGCTGGCCACACCAAGCAGGAAGC
ACAAACTCCCCCAAGCTGACTCATCCTAACTAACAGTCACGCCGTGGGATGTCTCTGTCC
ACATTAAACTAACAGCATTAATGCAGTCAAAAAAAAAAAAAAAAAA

Protein Sequence

>1436 : length: 972
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTL
YSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED
QDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSAL
MGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHN
NTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQPEPKLANATTKDTY
RHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRYPPEVSVIWTFINGSGTLLCA
ASGYPQPNVTWLQCSGHTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHN
QTYECRAHNSVGSGSWAFIPISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLLYKY
KQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
AFGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVL
VITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYKNIHLEKKYVRRDSGFSSQGV
DTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVA
ARNVLLTNGHVAKIGDFGLARDIMNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWS
YGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIA
QPLLQPNNYQFC