ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1435

Name

CSF1

Synonym

CSF-1|MCSF;colony stimulating factor 1 (macrophage);CSF1;colony stimulating factor 1 (macrophage)

Definition

lanimostim|macrophage colony-stimulating factor 1

Position

1p13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

mets affect on macrophage differentiation;PID BioCarta;100169

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

Integrins in angiogenesis;PID Curated;200109

Disease

Pre-Eclampsia;FunDO

Disease

Pulmonary fibrosis;FunDO

Disease

Colon cancer;FunDO

Disease

Squamous cell cancer;FunDO

Disease

Prostate cancer;FunDO

Disease

Metastasis to lymph nodes;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Albers-Schonberg disease;FunDO

Disease

Periodontitis;FunDO

Disease

Leukemia;FunDO

Disease

Synovitis;FunDO

Disease

Pancreas cancer;FunDO

Disease

Paget's disease;NHGRI

Disease

Thromboangiitis obliterans;FunDO

Disease

Histiocytosis;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to cell senescence gene database

1435

Links to epithelial mesenchymal transition gene database

1435

Links to ovarian cancer gene database

1435

Links to endometrial cancer gene database

1435

Links to iHOP

1435

Sequence Information

Nucleotide Sequence

>1435 : length: 4249
AGTGCAGCGCAGAAGACAGAGGGTGACTAGGAAGACGCGCGAGCGGGGCTGGCCGGCCGG
CGGGTGGGGGAGGGGAGGCGGGGGAAGGCGGCTGAGTGGGCCTCTGGAGTGTGTGTGTCT
GTGTCAGTGTGTGTGTGTGTGTGTGTATGTGTGTGTCTGGCGCCTGGCCAGGGTGATTTC
CCATAAACCACATGCCCCCCAGTCCTCTCTTAAAAGGCTGTGCCGAGGGCTGGCCAGTGA
GGCTCGGCCCGGGGAAAGTGAAAGTTTGCCTGGGTCCTCTCGGCGCCAGAGCCGCTCTCC
GCATCCCAGGACAGCGGTGCGGCCCTCGGCCGGGGCGCCCACTCCGCAGCAGCCAGCGAG
CGAGCGAGCGAGCGAGGGCGGCCGACGCGCCCGGCCGGGACCCAGCTGCCCGTATGACCG
CGCCGGGCGCCGCCGGGCGCTGCCCTCCCACGACATGGCTGGGCTCCCTGCTGTTGTTGG
TCTGTCTCCTGGCGAGCAGGAGTATCACCGAGGAGGTGTCGGAGTACTGTAGCCACATGA
TTGGGAGTGGACACCTGCAGTCTCTGCAGCGGCTGATTGACAGTCAGATGGAGACCTCGT
GCCAAATTACATTTGAGTTTGTAGACCAGGAACAGTTGAAAGATCCAGTGTGCTACCTTA
AGAAGGCATTTCTCCTGGTACAAGACATAATGGAGGACACCATGCGCTTCAGAGATAACA
CCCCCAATGCCATCGCCATTGTGCAGCTGCAGGAACTCTCTTTGAGGCTGAAGAGCTGCT
TCACCAAGGATTATGAAGAGCATGACAAGGCCTGCGTCCGAACTTTCTATGAGACACCTC
TCCAGTTGCTGGAGAAGGTCAAGAATGTCTTTAATGAAACAAAGAATCTCCTTGACAAGG
ACTGGAATATTTTCAGCAAGAACTGCAACAACAGCTTTGCTGAATGCTCCAGCCAAGATG
TGGTGACCAAGCCTGATTGCAACTGCCTGTACCCCAAAGCCATCCCTAGCAGTGACCCGG
CCTCTGTCTCCCCTCATCAGCCCCTCGCCCCCTCCATGGCCCCTGTGGCTGGCTTGACCT
GGGAGGACTCTGAGGGAACTGAGGGCAGCTCCCTCTTGCCTGGTGAGCAGCCCCTGCACA
CAGTGGATCCAGGCAGTGCCAAGCAGCGGCCACCCAGGAGCACCTGCCAGAGCTTTGAGC
CGCCAGAGACCCCAGTTGTCAAGGACAGCACCATCGGTGGCTCACCACAGCCTCGCCCCT
CTGTCGGGGCCTTCAACCCCGGGATGGAGGATATTCTTGACTCTGCAATGGGCACTAATT
GGGTCCCAGAAGAAGCCTCTGGAGAGGCCAGTGAGATTCCCGTACCCCAAGGGACAGAGC
TTTCCCCCTCCAGGCCAGGAGGGGGCAGCATGCAGACAGAGCCCGCCAGACCCAGCAACT
TCCTCTCAGCATCTTCTCCACTCCCTGCATCAGCAAAGGGCCAACAGCCGGCAGATGTAA
CTGGTACCGCCTTGCCCAGGGTGGGCCCCGTGAGGCCCACTGGCCAGGACTGGAATCACA
CCCCCCAGAAGACAGACCATCCATCTGCCCTGCTCAGAGACCCCCCGGAGCCAGGCTCTC
CCAGGATCTCATCACTGCGCCCCCAGGGCCTCAGCAACCCCTCCACCCTCTCTGCTCAGC
CACAGCTTTCCAGAAGCCACTCCTCGGGCAGCGTGCTGCCCCTTGGGGAGCTGGAGGGCA
GGAGGAGCACCAGGGATCGGAGGAGCCCCGCAGAGCCAGAAGGAGGACCAGCAAGTGAAG
GGGCAGCCAGGCCCCTGCCCCGTTTTAACTCCGTTCCTTTGACTGACACAGGCCATGAGA
GGCAGTCCGAGGGATCCTCCAGCCCGCAGCTCCAGGAGTCTGTCTTCCACCTGCTGGTGC
CCAGTGTCATCCTGGTCTTGCTGGCCGTCGGAGGCCTCTTGTTCTACAGGTGGAGGCGGC
GGAGCCATCAAGAGCCTCAGAGAGCGGATTCTCCCTTGGAGCAACCAGAGGGCAGCCCCC
TGACTCAGGATGACAGACAGGTGGAACTGCCAGTGTAGAGGGAATTCTAAGCTGGACGCA
CAGAACAGTCTCTCCGTGGGAGGAGACATTATGGGGCGTCCACCACCACCCCTCCCTGGC
CATCCTCCTGGAATGTGGTCTGCCCTCCACCAGAGCTCCTGCCTGCCAGGACTGGACCAG
AGCAGCCAGGCTGGGGCCCCTCTGTCTCAACCCGCAGACCCTTGACTGAATGAGAGAGGC
CAGAGGATGCTCCCCATGCTGCCACTATTTATTGTGAGCCCTGGAGGCTCCCATGTGCTT
GAGGAAGGCTGGTGAGCCCGGCTCAGGACCCTCTTCCCTCAGGGGCTGCACCCTCCTCTC
ACTCCCTTCCATGCCGGAACCCAGGCCAGGGACCCACCGGCCTGTGGTTTGTGGGAAAGC
AGGGTGGACGCTGAGGAGTGAAAGAACCCTGCACCCAGAGGGCCTGCCTGGTGCCAAGGT
ATCCCAGCCTGGACAGGCATGGACCTGTCTCCAGAGAGAGGAGCCTGAAGTTCGTGGGGC
GGGACAGCGTCGGCCTGATTTCCCGTAAAGGTGTGCAGCCTGAGAGACGGGAAGAGGAGG
CCTCTGGACCTGCTGGTCTGCACTGACAGCCTGAAGGGTCTACACCCTCGGCTCACCTAA
GTGCCCTGTGCTGGTTGCCAGGCGCAGAGGGGAGGCCAGCCCTGCCCTCAGGACCTGCCT
GACCTGCCAGTGATGCCAAGAGGGGGATCAAGCACTGGCCTCTGCCCCTCCTCCTTCCAG
CACCTGCCAGAGCTTCTCCAGGAGGCCAAGCAGAGGCTCCCCTCATGAAGGAAGCCATTG
CACTGTGAACACTGTACCTGCCTGCTGAACAGCCTGCCCCCGTCCATCCATGAGCCAGCA
TCCGTCCGTCCTCCACTCTCCAGCCTCTCCCCAGCCTCCTGCACTGAGCTGGCCTCACCA
GTCGACTGAGGGAGCCCCTCAGCCCTGACCTTCTCCTGACCTGGCCTTTGACTCCCCGGA
GTGGAGTGGGGTGGGAGAACCTCCTGGGCCGCCAGCCAGAGCCGGTCTTTAGGCTGTGTT
GTTCGCCCAGGTTTCTGCATCTTGCACTTTGACATTCCCAAGAGGGAAGGGACTAGTGGG
AGAGAGCAAGGGAGGGGAGGGCACAGACAGAGAGGCTACAGGGCGAGCTCTGACTGAAGA
TGGGCCTTTGAAATATAGGTATGCACCTGAGGTTGGGGGAGGGTCTGCACTCCCAAACCC
CAGCGCAGTGTCCTTTCCCTGCTGCCGACAGGAACCTGGGGCTGAACAGGTTATCCCTGT
CAGGAGCCCTGGACTGGGCTGCATCTCAGCCCCACCTGCATGGTATCCAGCTCCCATCCA
CTTCTCACCCTTCTTTCCTCCTGACCTTGGTCAGCAGTGATGACCTCCAACTCTCACCCA
CCCCCTCTACCATCACCTCTAACCAGGCAAGCCAGGGTGGGAGAGCAATCAGGAGAGCCA
GGCCTCAGCTTCCAATGCCTGGAGGGCCTCCACTTTGTGGCCAGCCTGTGGTGGTGGCTC
TGAGGCCTAGGCAACGAGCGACAGGGCTGCCAGTTGCCCCTGGGTTCCTTTGTGCTGCTG
TGTGCCTCCTCTCCTGCCGCCCTTTGTCCTCCGCTAAGAGACCCTGCCCTACCTGGCCGC
TGGGCCCCGTGACTTTCCCTTCCTGCCCAGGAAAGTGAGGGTCGGCTGGCCCCACCTTCC
CTGTCCTGATGCCGACAGCTTAGGGAAGGGCAGTGAACTTGCATATGGGGCTTAGCCTTC
TAGTCACAGCCTCTATATTTGATGCTAGAAAACACATATTTTTAAATGGAAGAAAAATAA
AAAGGCATTCCCCCTTCATCCCCCTACCTTAAACATATAATATTTTAAAGGTCAAAAAAG
CAATCCAACCCACTGCAGAAGCTCTTTTTGAGCACTTGGTGGCATCAGAGCAGGAGGAGC
CCCAGAGCCACCTCTGGTGTCCCCCCAGGCTACCTGCTCAGGAACCCCTTCTGTTCTCTG
AGAAGTCAAGAGAGGACATTGGCTCACGCACTGTGAGATTTTGTTTTTATACTTGGAAGT
GGTGAATTATTTTATATAAAGTCATTTAAATATCTATTTAAAAGATAGGAAGCTGCTTAT
ATATTTAATAATAAAAGAAGTGCACAAGCTGCCAAAAAAAAAAAAAAAA

Protein Sequence

>1435 : length: 554
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA
DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG
HERQSEGSSSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG
SPLTQDDRQVELPV