ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1410

Name

CRYAB

Synonym

CMD1II|CRYA2|CTPP2|CTRCT16|HEL-S-101|HSPB5|MFM2;crystallin, alpha B;CRYAB;crystallin, alpha B

Definition

alpha-crystallin B chain|epididymis secretory protein Li 101|heat shock protein beta-5|heat-shock 20 kD like-protein|renal carcinoma antigen NY-REN-27|rosenthal fiber component

Position

11q22.3-q23.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141

Pathway

Angiogenesis;PANTHER;P00005

Disease

Cataract, posterior polar 2;OMIM

Disease

Myopathy, cardioskeletal, desmin-related, with cataract;OMIM

Disease

Myopathy;FunDO

Disease

multiple sclerosis;GAD

Disease

Abortion;FunDO

Disease

IMMUNE;GAD

Disease

Brain tumor;FunDO

Disease

Breast cancer;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

1410

Links to epithelial mesenchymal transition gene database

1410

Links to ovarian cancer gene database

1410

Links to endometrial cancer gene database

1410

Links to iHOP

1410

Sequence Information

Nucleotide Sequence

>1410 : length: 1132
CCATTTATTACATTTTTTCATGCACTGTCAAGTTTATCCTCCGTCCCCTAACTTCTCTAC
AGGATACCCCTTTCTGGTTTGGTTCATGACAATCTGCAGGGAAAGAGCTGCCTTCAAACT
CCTTTGCTTATCTCTTCCAACACCTTGGACTCTTGACCGATTTTACCATCTCAGGTTTCA
GAGCCAGGAGAGAGCCCTGCCTCATCCTGAGCTGTTCATCCCCATGGGTATTTTCTGCCT
TTCTATTCCCTCTTCTATGATTTTCTGGGTTTCTCAGGGCTACGACAGGGCGCTGGCCTG
GGTCCAATCAAGCCCTACGAGGAAACAATATAGGGACGCCCATTTGTCCTAAGAGGGTGG
AAGAACAGGGTGAACAAATAAGGTTGACAGAGCTGTCACAGATAACACTCTGGTTTAAAA
ATATTCAAGTGTGAGTAAACAGGAGCTGAGTGGGCAAGGGCTTTGGAAGGACAAGCAGGA
CCAGCAGAACATTCCAGATTGGGTGGGTGGAAAACTGGCAAAGAGACCTGAGCCAGAAGA
AGAGGCCTTTGTCTCACAGACAAACCACAAAGCCAGGCATTGGAGTCAGAGAGGCAGCAG
ATGCCAGGCTTGCACCCATCCTTGCGACTGGTCCCCTGGGTGATCTGTCTTCTTCTCTGT
CCCTATGCGCCTGGAGAAGGACAGGTTCTCTGTCAACCTGGATGTGAAGCACTTCTCCCC
AGAGGAACTCAAAGTTAAGGTGTTGGGAGATGTGATTGAGGTGCATGGAAAACATGAAGA
GCGCCAGGATGAACATGGTTTCATCTCCAGGGAGTTCCACAGGAAATACCGGATCCCAGC
TGATGTAGACCCTCTCACCATTACTTCATCCCTGTCATCTGATGGGGTCCTCACTGTGAA
TGGACCAAGGAAACAGGTCTCTGGCCCTGAGCGCACCATTCCCATCACCCGTGAAGAGAA
GCCTGCTGTCACCGCAGCCCCCAAGAAATAGATGCCCTTTCTTGAATTGCATTTTTTAAA
ACAAGAAAGTTTCCCCACCAGTGAATGAAAGTCTTGTGACTAGTGCTGAAGCTTATTAAT
GCTAAGGGCAGGCCCAAATTATCAAGCTAATAAAATATCATTCAGCAACAGA

Protein Sequence

>1410 : length: 175
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW
FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK