ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

137964

Name

AGPAT6

Synonym

1-AGPAT 6|LPAAT-zeta|LPAATZ|TSARG7;1-acylglycerol-3-phosphate O-acyltransferase 6;AGPAT6;1-acylglycerol-3-phosphate O-acyltransferase 6

Definition

1-AGP acyltransferase 6|1-acyl-sn-glycerol-3-phosphate acyltransferase zeta|1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acid acyltransferase, zeta)|glycerol-3-phosphate acyltransferase 6|lysophosphatidic acid acyltransferase zeta|test

Position

8p11.21

Gene Type

protein-coding

Pathways and Diseases

Pathway

CDP-diacylglycerol biosynthesis I;BioCyc;PWY-5667

Pathway

phosphatidylglycerol biosynthesis II (non-plastidic);BioCyc;PWY4FS-8

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

Glycerolipid metabolism;KEGG PATHWAY;hsa00561

Pathway

Glycerophospholipid metabolism;KEGG PATHWAY;hsa00564

Pathway

Metabolism of lipids and lipoproteins;Reactome;REACT:22258

Pathway

Triglyceride Biosynthesis;PID Reactome;500875

Pathway

triacylglycerol biosynthesis;BioCyc;TRIGLSYN-PWY

External Links

Links to cell senescence gene database

137964

Links to epithelial mesenchymal transition gene database

137964

Links to ovarian cancer gene database

137964

Links to endometrial cancer gene database

137964

Links to iHOP

137964

Sequence Information

Nucleotide Sequence

>137964 : length: 6328
GCACGTCCTGACGCAGCTTGGGCCCGCGGCGGCGGCAAGGGCGGGAGGGAGCGGTCGCCG
CGGGATTTGGAGCTGCCTAGCCTCGCGGTCGCTTTGGCAGCATGTAAGCAGCTGTTTGCC
AAGAACCCAGGTCACTGCTAAGAAAGGGTGCCTTCGGGAGAAGAGTGTCCAGAGGATACC
AATGCCAGATGCATCTGGAGTTACACTCAGCACTCGCAGTATGAGACATTGTGTGCCAGC
ATCTCTTTCCTTCTGGCAAAGACTGTAGCTCTCCAGGTAGGAGGATCCTGGAAGCTGTGA
GCACCAGGAGCCTTGCCAGAGGAGGATGGGGCCAGATATGAACTCTCTACCATGAACATG
GTTCTCGGCTTATGAAGGAATTTTAAGTAAAACAGTTATTTAATTTCCACATATTCAAGT
CAAAAGCCTTCTGTGTGAAGTGCCAGTGATTACCCCTCCACAGGAGTTATCAGGATTTTT
CTGGCACCAAGTTTAATTCTTCTTCGTACTTCTGGTAGTGACAGATCTGCAGGACAGATT
TATCTGTTGAATGCTCTTGGGCAGGAAAACCATGTAAAACCTCTGGAAGCAGCATCAGGA
CAGCAGAGCAGAGCCCCCGTCCTCACTGCTCACTTGCACAGAAACTCCATCTGGACTCGG
ATGCTTTTACTGAAGACCCATCTAGCTTCAATCATCTTTAGAGTCCATCCATTCTGGAGA
GACCTGGCGTTTGCAGTTGCCTCCTGTGGCCGTGTTTTTCTGTCATTCTGTTCCCAGGCC
TTCTATTCAGGCGGTTGAAGGGTGTGGACTTTGGAATGGGGTTTGCTGTTCTTCGGGAAC
TTGCTTCCTTTCCCTGGCTGGTGCTGTCAGGAAGGACCATCTGAAGGCTGCAATTTGTTC
TTAGGGAGGCAGGTGCTGGCCTGGCCTGGATCTTCCACCATGTTCCTGTTGCTGCCTTTT
GATAGCCTGATTGTCAACCTTCTGGGCATCTCCCTGACTGTCCTCTTCACCCTCCTTCTC
GTTTTCATCATAGTGCCAGCCATTTTTGGAGTCTCCTTTGGTATCCGCAAACTCTACATG
AAAAGTCTGTTAAAAATCTTTGCGTGGGCTACCTTGAGAATGGAGCGAGGAGCCAAGGAG
AAGAACCACCAGCTTTACAAGCCCTACACCAACGGAATCATTGCAAAGGATCCCACTTCA
CTAGAAGAAGAGATCAAAGAGATTCGTCGAAGTGGTAGTAGTAAGGCTCTGGACAACACT
CCAGAGTTCGAGCTCTCTGACATTTTCTACTTTTGCCGGAAAGGAATGGAGACCATTATG
GATGATGAGGTGACAAAGAGATTCTCAGCAGAAGAACTGGAGTCCTGGAACCTGCTGAGC
AGAACCAATTATAACTTCCAGTACATCAGCCTTCGGCTCACGGTCCTGTGGGGGTTAGGA
GTGCTGATTCGGTACTGCTTTCTGCTGCCGCTCAGGATAGCACTGGCTTTCACAGGGATT
AGCCTTCTGGTGGTGGGCACAACTGTGGTGGGATACTTGCCAAATGGGAGGTTTAAGGAG
TTCATGAGTAAACATGTTCACTTAATGTGTTACCGGATCTGCGTGCGAGCGCTGACAGCC
ATCATCACCTACCATGACAGGGAAAACAGACCAAGAAATGGTGGCATCTGTGTGGCCAAT
CATACCTCACCGATCGATGTGATCATCTTGGCCAGCGATGGCTATTATGCCATGGTGGGT
CAAGTGCACGGGGGACTCATGGGTGTGATTCAGAGAGCCATGGTGAAGGCCTGCCCACAC
GTCTGGTTTGAGCGCTCGGAAGTGAAGGATCGCCACCTGGTGGCTAAGAGACTGACTGAA
CATGTGCAAGATAAAAGCAAGCTGCCTATCCTCATCTTCCCAGAAGGAACCTGCATCAAT
AATACATCGGTGATGATGTTCAAAAAGGGAAGTTTTGAAATTGGAGCCACAGTTTACCCT
GTTGCTATCAAGTATGACCCTCAATTTGGCGATGCCTTCTGGAACAGCAGCAAATACGGG
ATGGTGACGTACCTGCTGCGAATGATGACCAGCTGGGCCATTGTCTGCAGCGTGTGGTAC
CTGCCTCCCATGACTAGAGAGGCAGATGAAGATGCTGTCCAGTTTGCGAATAGGGTGAAA
TCTGCCATTGCCAGGCAGGGAGGACTTGTGGACCTGCTGTGGGATGGGGGCCTGAAGAGG
GAGAAGGTGAAGGACACGTTCAAGGAGGAGCAGCAGAAGCTGTACAGCAAGATGATCGTG
GGGAACCACAAGGACAGGAGCCGCTCCTGAGCCTGCCTCCAGCTGGCTGGGGCCACCGTG
CGGGGTGCCAACGGGCTCAGAGCTGGAGTTGCCGCCGCCGCCCCCACTGCTGTGTCCTTT
CCAGACTCCAGGGCTCCCCGGGCTGCTCTGGATCCCAGGACTCCGGCTTTCGCCGAGCCG
CAGCGGGATCCCTGTGCACCCGGCGCAGCCTACCCTTGGTGGTCTAAACGGATGCTGCTG
GGTGTTGCGACCCAGGACGAGATGCCTTGTTTCTTTTACAATAAGTCGTTGGAGGAATGC
CATTAAAGTGAACTCCCCACCTTTGCACGCTGTGCGGGCTGAGTGGTTGGGGAGATGTGG
CCATGGTCTTGTGCTAGAGATGGCGGTACAAGAGTCTGTTATGCAAGCCCGTGTGCCAGG
GATGTGCTGGGGGCGGCCACCCGCTCTCCAGGAAAGGCACAGCTGAGGCACTGTGGCTGG
CTTCGGCCTCAACATCGCCCCCAGCCTTGGAGCTCTGCAGACATGATAGGAAGGAAACTG
TCATCTGCAGGGGCTTTCAGCAAAATGAAGGGTTAGATTTTTATGCTGCTGCTGATGGGG
TTACTAAAGGGAGGGGAAGAGGCCAGGTGGGCCGCTGACTGGGCCATGGGGAGAACGTGT
GTTCGTACTCCAGGCTAACCCTGAACTCCCCATGTGATGCGCGCTTTGTTGAATGTGTGT
CTCGGTTTCCCCATCTGTAATATGAGTCGGGGGGAATGGTGGTGATTCCTACCTCACAGG
GCTGTTGTGGGGATTAAAGTGCTGCGGGTGAGTGAAGGACACATCACGTTCAGTGTTTCA
AGTACAGGCCCACAAAACGGGGCACGGCAGGCCTGAGCTCAGAGCTGCTGCACTGGGCTT
TGGATTTGTTCTTGTGAGTAAATAAAACTGGCTGGTGAATGAACTGGGGGACTTCTCCCT
TTACTTTCTCCCCTGGCTGTGGCCCTGAGTAGCAGGCTTCTCGTGAGGATTCCCGTTCTC
TTCTGGGAGCATGGCCCTGGGGCTGCGGAGAAGCCAACTGACTGCTGGAGCGAGGAACCC
TGCAGCTCAGAAGGTGAACAGCTCGTCTCAGATGCTTGCAGATCTTTGGTTAATTTAGAA
TTTCCAGCACAGACGTGGATTTCTCCAGAGACGGGGTGTGTGCGGGTCGCTGATGTGAGG
CCTAGGGGAAGCAATGAGTAAACTCCAGGGTGGGGGAGGAGCAAGGGCCCGGGGAGGGCT
GCAGAGGGGCCGGGGCGGGGCAGGGCCTGTGCTGCATGGTGGCTTCTGCAGGGGAGGGAC
AGGGGAGGGCTGCAGAGGGGCAGGGTGGGCAGGGCATGTGCTGCATGGCAGCTTCTGCAC
AGCCAGAGCAGGCACCACAGGAAAAGAGTCGGCCACTGGTGCCTGCTGTACAGTCACAGT
GGAGGCAGAGCCAAGGCCAAGCAGCCCCTGTGGGTTCTGGGGTTTCACCAGTTTCATGCT
CCTCAGCTCCCCATTCATGCCCCACCAGCCCTCACTTGGGACCCATGCTCCCTCGTGGCA
CAGTCATGATGCCTCTCAGGATTTTGTGCCTGTGGTGCTGAGTGTCACGTCCCCAAGGTC
GCCCTCTGGCCTGCAGTTCAGGGAGTGGGTGGGAGTGAAGCTGTGCTCCTGGGGCTGCAG
ACAGATCCACTTTGCATGTGGTACCTGCTGGGTTGGCCCTGCAATCTCCTTTTCTCTGCA
CCTACCTGTGACCTCCCTGGGAGAGCCTCCCATTTCCTCACCTGCCCTGTTGCCAGCCCG
GGGGAAATCTTTTTGCTCTCAAATGAAGACTGAAAAAATAAAGTCAGTGTTATGACTAAT
AAGTCTCTTAGGAACTGTTTTACAAAATGCTTAAGAATAAAAAGTGATTTTCAGCTTTTA
TAGGTGATGTTTACAGTGTTTGTAAACCAACTGGAGGGATCAGTAATTGGTCTTAAAAGA
TCAGGTTCTCTTTTAAAAAGTTCATCTGAAACTTTATGGTTTGTTACTTTCGTGATTTGC
ATAGGTATTTATATATACACACACACACAGGTTTTGCTTTTGTCTCACATTCAGCACAGC
TGTCTGCGGCCCCTGCCGGCAGGTGTGGCCGCACCTGGTGTGAAGTCACGTGGAGTCAGT
GCTGTGGAGGGAAGTCCTGTGCGGGCCGGGCAGTGAGGAGAGCACTGATTCACGCCTGCA
GAAACGTAACCTCCCCTTTCCGTGTATGCCTTTTACCATCATCCAGGCGACTGCTCCATC
CTTTTAAATTAGGGGTCCTGCAAGCCCCAAGTGACCCATAGTCAGAGTATCTGGTTTGGG
GTAACCGAGTTGGTCTTATGGGGCAAAAACTCAAGACACTTAGAAACATGCAAAGTACAA
AATAATGTGTTCCCTCCTGTTACCCCAGCAAGGGTGGGGCTGAGCTGGGAATGACACCCA
GTGGTGTAATGAGTGGAAAGTGCTGGTCAGCTGCTAACCCCCCTCCAAGCCTGCTGCACC
TTCACTTCTCTGCATCCGTCTCCTGAGTCATAACTAGGGACTTGGCTAGATGACCTCAGA
GACCTCGTCCACCTCTGAATTCTCTGTTTTTAAGCCCATAGTTCAAACTTTGGCTTTGAT
CTCTGAAGTCTTCTGGGTTTGGAAATACGGGAAGTCAGCTTTGAATCCATTGCTTCTCTA
AAACATCAGGGCTAGTGGAACTAACCCACTTGAGGGTGACCTCAAGGGCTTTAGGCAGCC
ATGGGGCTGGGGCCATACTGCTCTCAGGCTGGGCAGTATCTTCATTGTGGTTCTCAGACA
GCCTTTTTTACTCAAACATGAGACTTTCCACCCACCAGTTAGGGAACTTTTTTTTTTTTT
TTAAACACGGAGTTTCACTCTTGTTGCCCATGCTGGAGTGCAATGGCACAATCTCAGCTC
CACTGCAACCTCTACCTCCCGGGTTCAAGTGATTCTTCTGCCTCAGCCTCCAAGTAGCTG
AGATTACAGGCATGCACCACCACACCCAGCTAATTTTTTGTATTTAGTAGAGACTGGGTT
TCACCATGTTGGTCAGGCTGGTCTCCAACTCCTGACCTCAGGTGATCCACTCTCCTTGGC
CTCCCAAAGTTCTGGGATTACAGGCGTGAGCCACTGCGCCCAGCCAAGAGGGAACTTTTT
AATAAAGCTAGTGGGATTCCCTTGACAGCAGAACCAGCCTTGGGACTTGATGCTTCACCG
TGTCAGAATCCGTCCCTGGTGCTGCCTTTCAGAGAAGAGGCTTGATGTGTGAGGGGTCAG
GGGGAGTGCTCCAGATCCCTGAAATGCCCTTCCCAGACCAGTGACAGGCATTTTTGGGTG
CCATCGTGTGACCTTCACGGCACAGCAAACAGTGGGCACTAACCCTGTTGTCCTGTGGAA
ATCTGGGTCTCTGAATCCTGCCATTTCCTTCCTGGAATTGGCCAGGAACTTGATTTTCTG
GGCTATTGCTTGCTAGTGTCCCCTGATGCATGAAGGATCCCCCCATGTCATAGGTCCCAC
CTGCCTGCTGTGCATCCCGGGTGGCCAGACTCGGCTTCTCCAGGTGCACTTGTCCCAGGT
GGCCCGGTCCGTAGGCTGGAAGGGCAGCTGCAGGTGCACTGCCTCGCGGACAGGTTAGGA
TATGGCCACGCAGCCATCCATCTTCTACAGCACGCACACCCCACTCTCTCCCCCAGTCAA
TATGTCTCTCTCCGATGGGAAAGTTAATAAATTTTGCTCTAGATTAAAAGTATTGATCAT
TTCATTTGTAAACGATAAATAAAAAGGGGGAACTTTTCATTGCGCCAGGGGTGGCACCTG
GCGTGTGTTGCGGGGGTGATTGCGCTGGCTGCCGGGGGGTGGGCTTCTCATATGCATTCT
GGCCGGCCAGCTGCATTGATTTCCTATTAGTCTCCCAGCACCACCCAGTAACACATCATT
TCAGTACCTGCTATTAATGGTCTTTTGATAAATAATCACTTGTAAGTCAATAAATTTTTA
TTAAACAGTGAAAAAAAAAAAAAAAAAA

Protein Sequence

>137964 : length: 456
MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAIFGVSFGIRKLYMKSLLKIFAWATLR
MERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCR
KGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCFLLPLRI
ALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMCYRICVRALTAIITYHDRENRPRN
GGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHL
VAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAF
WNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDLL
WDGGLKREKVKDTFKEEQQKLYSKMIVGNHKDRSRS