ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

132851

Name

SPATA4

Synonym

SPEF1B|TSARG2;spermatogenesis associated 4;SPATA4;spermatogenesis associated 4

Definition

spermatogenesis-associated protein 4|testis and spermatogenesis cell related protein 2|testis and spermatogenesis cell-related protein 2|testis spermatocyte apoptosis-related gene 2 protein

Position

4q34.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

132851

Links to epithelial mesenchymal transition gene database

132851

Links to ovarian cancer gene database

132851

Links to endometrial cancer gene database

132851

Links to iHOP

132851

Sequence Information

Nucleotide Sequence

>132851 : length: 1233
GCGCTGAGGTCTCGCCCCATAAGACTCCGCCCCGCCCCACGAGACCGCGCCGCCAGCAAT
AAGGCCCAGCCCCGCCTTCTGCTGTTGCCGCAGCAACCCAGAAAGCGTCATGGCTGCCGC
CGGCCAGGAAAAAGGGTATTTGACACAGACTGCGGCAGCCCTAGACAAGTCACCGTCACT
TTCGCCACAGCTAGCAGCTCCCATCCGAGGGAGGCCTAAGAAGTGTCTGGTCTATCCGCA
TGCGCCGAAGAGCTCCCGCTTGTCTCGTTCCGTTCTGCGTTGGCTTCAGGGTCTGGATCT
CAGCTTCTTCCCCAGGAACATCAACAGAGATTTTTCAAATGGCTTCCTAATTGCAGAAAT
ATTCTGTATATATTACCCCTGGGAACTTGAATTATCATCCTTTGAAAACGGGACCTCTTT
AAAAGTCAAGTTGGATAACTGGGCACAGTTGGAGAAGTTCCTGGCAAGAAAAAAATTTAA
ATTACCTAAAGAACTAATCCATGGAACAATTCATTGTAAAGCTGGAGTGCCTGAAATATT
GATAGAAGAGGTTTACACTTTATTAACACATCGAGAAATTAAAAGTATCCAGGATGACTT
TGTGAATTTCACGGACTATAGCTACCAGATGCGTTTACCCCTGGTTTCCAGGTCTACAGT
TTCGAAGTCTATTAAAGATAACATTAGGTTATCAGAATTACTAAGCAATCCCAACATGCT
GACCAATGAACTTAAAGCGGAGTTCCTCATCCTTTTACATATGTTGCAAAGAAAATTAGG
CAGAAAATTGAATCCAGAATGGTTTGATGTGAAACCAACAGTGGGAGAAGTTACTCTCAA
TCACCTTCCTGCCCAAGCCTCTGGGCGCAGATATAATTTAAAAGTTAAAAGAGGAAGAGT
TGTCCCTGTTTTACCAAATATAGGTAGTGGTGGCAGTTCACATAGAGAAATACATGTGAA
GCAAGCTGGACAACATTCTTATTACTCTGCTATGAAACCTATCAGAAACATGGACAAGAA
ACCTTGAAAAGCACCTGTCAAATGGCTTTGAAGAAGTGATGCCACCATCTCTAGCCATAA
TAAAGAAACAGAATCACCTAGTATTGGATGTATTTCAATAATAAATAGAGTGGTGTCTTT
TCCATAATTGTGTTAAAGAACATTTCTTTTCCATTCAATTTGTTTATTAAACTCCTATGC
CAGGCATTGTTGAAAATACAAAATTAAATAAAT

Protein Sequence

>132851 : length: 305
MAAAGQEKGYLTQTAAALDKSPSLSPQLAAPIRGRPKKCLVYPHAPKSSRLSRSVLRWLQ
GLDLSFFPRNINRDFSNGFLIAEIFCIYYPWELELSSFENGTSLKVKLDNWAQLEKFLAR
KKFKLPKELIHGTIHCKAGVPEILIEEVYTLLTHREIKSIQDDFVNFTDYSYQMRLPLVS
RSTVSKSIKDNIRLSELLSNPNMLTNELKAEFLILLHMLQRKLGRKLNPEWFDVKPTVGE
VTLNHLPAQASGRRYNLKVKRGRVVPVLPNIGSGGSSHREIHVKQAGQHSYYSAMKPIRN
MDKKP