ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1326

Name

MAP3K8

Synonym

AURA2|COT|EST|ESTF|MEKK8|TPL2|Tpl-2|c-COT;mitogen-activated protein kinase kinase kinase 8;MAP3K8;mitogen-activated protein kinase kinase kinase 8

Definition

Ewing sarcoma transformant|augmented in rheumatoid arthritis 2|cot (cancer Osaka thyroid) oncogene|proto-oncogene c-Cot|proto-oncogene serine/threoine protein kinase|tumor progression locus 2

Position

10p11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

Ras signaling in the CD4+ TCR pathway;PID Curated;200088

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

CD28 dependent PI3K/Akt signaling;PID Reactome;500485

Pathway

JNK signaling in the CD4+ TCR pathway;PID Curated;200129

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Interleukin-1 signaling;PID Reactome;500490

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Disease

Lung cancer, somatic;OMIM

External Links

Links to cell senescence gene database

1326

Links to epithelial mesenchymal transition gene database

1326

Links to ovarian cancer gene database

1326

Links to endometrial cancer gene database

1326

Links to iHOP

1326

Sequence Information

Nucleotide Sequence

>1326 : length: 4870
GCAGCTCGGAGGCTGGAGGACCCGATCCTCCCAAATGCTGGGTGCTTTGATAATTTATAA
GCCTTTTAGGCTCCCTTGACTTAGAGAACCAGGAGGAAAGGAGTGGGAGTGTGGGTTGGC
GGAGCCCAGAGACTTGTGAATGGCTGGAACTAAATTCAAGTTTGTAACCCGGACTCTATC
CCATGACTAAAGAGGTCATAGCAGAACACGAAGGCTGGGCTTTTGGTCTAAGAAAGAATA
CTAGGAGAAAAAAAAAGTTATTTTCACGGAAGTTGTTTTCGAGCGATAGTGCATGATCAG
GACTCTGAAATTTTTCTAGCTCTGGGCGGAGAAGGACGCCTAGGGATTGTCTCCATAGTT
AACAGGGGAAGGCCACCGGCTGCCTGTAAGAGAGAAACGTTGCGATGCTTGTCTATTTCA
CTTTTGGGAAGACAAGATTAAAGGCTGCTCTTGATAAAAAACAGGGACAGAAAGGCTCTT
GCAGTTGCTTTACATACCTGTGGCCTGAGTCGTTTGTGCCAAGGAGAGTGTAATCCACTT
CCAGCTGACGCCCCCAGCTCTCTGCGACGGATTGAGGTTTGTGTGCAGGACGTCTGGCAT
ACGGCCCATGAGGACTTTGTCGTGTAAAGCAAATGGGAACGTTGAGGCATGTAGAGGTTT
TGAAGCAGAGTGTCGGTCCTTCCTTCCATACGCCTGAAACGCATAATCCGGGGCTTTTTG
AGAGCAAAAACATAGTCAGAAATGTGCCCTGAGGGAGAATGTACTATTTTGGCACACATA
TGTATATATGTATATATAATTTTTAAATTTTTTTTGAGAGGGGGTTTCACTCTTGTCGCC
CAGGCTGGAGCGCAATGGCGCGATCTCGGCTCACTGCAACCTCCACCTCCCGGGTTCAAG
CGATTCTCTTGCCTCAGCCTCCCGAGTAGCTGGGATTACAGGCGCCCGCCGCCACGCCCG
GCTAATTTTTGTAGAGACAGGGTTTCACCATGTTGGCCAGGCTGGTCTTGAACTCCTGAC
CTCAGGTGATGCACCCTCCTTGGCCTCCCAAAGTGCTGAGATTACAGGCATGAGCCACTG
TGCCCGGCCTAAAAAAATATTTTAAATGAGAAATAACACAAGTAATAGTCATTCTTTGTT
AGGCAGAAGCATATGCTGTTATGCTGGCCATTTTCATTCACACTTGCCAGGAAACACTCA
CATTTTGTTTCTGTATATGGAGGCAGCCAAGAGTATTATGTTAATGTTTAGGAAGAGAAT
TTCCTCGTGATTTTATTGCTGATTTCTGAAATAATTCAGTGTAACTAATTTTGACTGTAT
TTGCACATCTCTCCAATTCCAAAAGCTGGCATAATTTTCTGTTTGGTTAGGAAGTAGGAA
TTTTATGAGGACTTTTATTGTAAACTGTGTCAAGGGAAAAATCATCTTATACTAAACGTC
TTTATTGCCAAACTAGAATACCTTCACAATCTGAACTTTCTCTAGATGGGCACAGATCAT
GAATAACTCAGAAACCATTAGCATATTGTGTGCTTAATTAAGGCTGGAAAGTGCTGAGGC
TTTTTGCAGGCGCAGTTAGCAGGCGAACTGGTCAGCAGGGTTTCTGGGGAACGTAGATTT
GCGTGACAGGGGCCCTGTGTTGCTAAGGAATTACTGCAGGCACTGAGAAAAGTCTCAGCG
TCAGACACTCCTCCACCTCCCGGGTCCTGCTTCCCTCCCTCTCCCCTTTCCAGGCAACTC
ACAGTTTAGGGGTGTGGTTGTGTGTGTTCAAGCTCTTGGGTTTTACATATAAATGCCTGA
GACTTTTCTGCAGGGTTTAAAAACTAACATCTTGTCTTACAGCTCTTTTAGGATTTGTCT
TTTAGAATCTCCAGTCCTCACAGGAAAACCCCCCAATTAAAAAAATAAAAGAATAAAGAA
TAAAAAGAATACCACTACTACTATAAAAAAAAAAAAAATCCTCTAAAATTTGTCTTCCCA
GATCAGCAGAGTGAATTTGAACTGTGTGGACTTTTTTCCTCTTTCTTTCTTGAGTCATGT
TAGTACTGAGAACTTTTTTTTTTTCTGTCAAATCATCTGTTTGATAAATAAGTCCAGGAG
ACTTGGATCCTTTCAACCCCTGAGGCCCTAAATTAGGCTGTTTTTTTTTTAACCTCTGTG
TTTCCAGTAAATTCGACAAGCAGAAACTGCAACTAAACGGCTCAGTAAAACCGAAGTCAA
ATGTTCCTCCATTAATCTAAGAAGTTGCTCTCCTAACTCAGCAGACTCCAAGAACCTGAA
TCACAATCTCCCTCGAAGATGTACAAGATCTCAGGAGGGGAAGCTGCCCCCTCACTCTAG
ATTTCACGGTGGTGATAACAGCCATGAAAGCATTTCATAGACTCTCCAGAAAGAGCAACA
GTAATGGAGTACATGAGCACTGGAAGTGACAATAAAGAAGAGATTGATTTATTAATTAAA
CATTTAAATGTGTCTGATGTAATAGACATTATGGAAAATCTTTATGCAAGTGAAGAGCCA
GCAGTTTATGAACCCAGTCTAATGACCATGTGTCAAGACAGTAATCAAAACGATGAGCGT
TCTAAGTCTCTGCTGCTTAGTGGCCAAGAGGTACCATGGTTGTCATCAGTCAGATATGGA
ACTGTGGAGGATTTGCTTGCTTTTGCAAACCATATATCCAACACTGCAAAGCATTTTTAT
GGACAACGACCACAGGAATCTGGAATTTTATTAAACATGATCCCACCAACATCCAGCAAG
ATCTGGGGAAGAAGCTTTGGGAGACTAACCTGGGAATTGCTTTGGGTCATCACTCCCCAA
AATGGACGTTACCAAATAGATTCCGATGTTCTCCTGATCCCCTGGAAGCTGACTTACAGG
AATATTGGTTCTGATTTTATTCCTCGGGGCGCCTTTGGAAAGGTATACTTGGCACAAGAT
ATAAAGACGAAGAAAAGAATGGCGTGTAAACTGATCCCAGTAGATCAATTTAAGCCATCT
GATGTGGAAATCCAGGCTTGCTTCCGGCACGAGAACATCGCAGAGCTGTATGGCGCAGTC
CTGTGGGGTGAAACTGTCCATCTCTTTATGGAAGCAGGCGAGGGAGGGTCTGTTCTGGAG
AAACTGGAGAGCTGTGGACCAATGAGAGAATTTGAAATTATTTGGGTGACAAAGCATGTT
CTCAAGGGACTTGATTTTCTACACTCAAAGAAAGTGATCCATCATGATATTAAACCTAGC
AACATTGTTTTCATGTCCACAAAAGCTGTTTTGGTGGATTTTGGCCTAAGTGTTCAAATG
ACCGAAGATGTCTATTTTCCTAAGGACCTCCGAGGAACAGAGATTTACATGAGCCCAGAG
GTCATCCTGTGCAGGGGCCATTCAACCAAAGCAGACATCTACAGCCTGGGGGCCACGCTC
ATCCACATGCAGACGGGCACCCCACCCTGGGTGAAGCGCTACCCTCGCTCAGCCTATCCC
TCCTACCTGTACATAATCCACAAGCAAGCACCTCCACTGGAAGACATTGCAGATGACTGC
AGTCCAGGGATGAGAGAGCTGATAGAAGCTTCCCTGGAGAGAAACCCCAATCACCGCCCA
AGAGCCGCAGACCTACTAAAACATGAGGCCCTGAACCCGCCCAGAGAGGATCAGCCACGC
TGTCAGAGTCTGGACTCTGCCCTCTTGGAGCGCAAGAGGCTGCTGAGTAGGAAGGAGCTG
GAACTTCCTGAGAACATTGCTGATTCTTCGTGCACAGGAAGCACCGAGGAATCTGAGATG
CTCAAGAGGCAACGCTCTCTCTACATCGACCTCGGCGCTCTGGCTGGCTACTTCAATCTT
GTTCGGGGACCACCAACGCTTGAATATGGCTGAAGGATGCCATGTTTGCTCTAAATTAAG
ACAGCATTGATCTCCTGGAGGCTGGTTCTGCTGCCTCTACACAGGGGCCCTGTACAGTGA
ATGGTGCCATTTTCGAAGGAGCAGTGTGACCTCCTGTGACCCGTGAATGTGCCTCCAAGC
GGCCCTGTGTGTTTGACATGTGAAGCTATTTGATATGCACCAGGTCTCAAGGTTCTCATT
TCTCAGGTGACGTGATTCTAAGGCAGGAATTTGAGAGTTCACAGAAGGATCGTGTCTGCT
GACTGTTTCATTCACTGTGCACTTTGCTCAAAATTTTAAAAATACCAATCACAAGGATAA
TAGAGTAGCCTAAAATTACTATTCTTGGTTCTTATTTAAGTATGGAATATTCATTTTACT
CAGAATAGCTGTTTTGTGTATATTGGTGTATATTATATAACTCTTTGAGCCTTTATTGGT
AAATTCTGGTATACATTGAATTCATTATAATTTGGGTGACTAGAACAACTTGAAGATTGT
AGCAATAAGCTGGACTAGTGTCCTAAAAATGGCTAACTGATGAATTAGAAGCCATCTGAC
AGCAGGCCACTAGTGACAGTTTCTTTTGTGTTCCTATGGAAACATTTTATACTGTACATG
CTATGCTGAAGACATTCAAAACGTGATGTTTTGAATGTGGATAAAACTGTGTAAACCACA
TAATTTTTGTACATCCCAAAGGATGAGAATGTGACCTTTAAGAAAAATGAAAACTTTTGT
AAATTATTGATGATTTTGTAATTCTTATGACTAAATTTTCTTTTAAGCATTTGTATATTA
AAATAGCATACTGTGTATGTTTTATATCAAATGCCTTCATGAATCTTTCATACATATATA
TATTTGTAACATTGTAAAGTATGTGAGTAGTCTTATGTAAAGTATGTTTTTACATTATGC
AAATAAAACCCAATACTTTTGTCCAATGTGGTTGGTCAAATCAACTGAATAAATTCAGTA
TTTTGCCTTA

Protein Sequence

>1326 : length: 594
MEGAPSRGENSGVGRGGGVPTAALAGRRLHQAQLESTLRKGLTGCRLATPPPSSSFPYPQ
RQGSAGLGSARGSGDPLSLRLPLPTPPGRPHSPCPRPDSPERATVMEYMSTGSDNKEEID
LLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSS
VRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMIPPTSSKIWGRSFGRLTWELLWV
ITPQNGRYQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQ
FKPSDVEIQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWV
TKHVLKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIY
MSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDI
ADDCSPGMRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLS
RKELELPENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG