ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1316

Name

KLF6

Synonym

BCD1|CBA1|COPEB|CPBP|GBF|PAC1|ST12|ZF9;Kruppel-like factor 6;KLF6;Kruppel-like factor 6

Definition

B-cell-derived protein 1|GC-rich binding factor|GC-rich sites-binding factor GBF|Krueppel-like factor 6|Kruppel-like zinc finger protein Zf9|core promoter element binding protein|core promoter element-binding protein|proto-oncogene BCD1|protooncogene B-ce

Position

10p15

Gene Type

protein-coding

External Links

Links to cell senescence gene database

1316

Links to epithelial mesenchymal transition gene database

1316

Links to ovarian cancer gene database

1316

Links to endometrial cancer gene database

1316

Links to iHOP

1316

Sequence Information

Nucleotide Sequence

>1316 : length: 4679
GAGCCAGGCGGGGGCGGAGGGGGAGGCTGGCAGCGGAGCTTTGAATAGGGAAGTTTTGCA
GGGGTTACGTTTGCAGTCAGTCCGGTGTTTGCAAATATTGTGTGGGCTCCGCGCGCTGCG
GGCTGCGGGAGGGTCCGGCCGGGCGTCTCTGCGAGCCTGGAGTTTGCATGAAACTTTCAC
CTGCGCTCCGGGGAGACTTTCGGCTCCGGCTCCCACCGCGCGCCTCGCCGCCCTCGCGAC
CGCGGGCTCCGTCCAACCCGGCCCGACATGGACGTGCTCCCCATGTGCAGCATCTTCCAG
GAGCTCCAGATCGTGCACGAGACCGGCTACTTCTCGGCGCTGCCGTCTCTGGAGGAGTAC
TGGCAACAGACCTGCCTAGAGCTGGAACGTTACCTCCAGAGCGAGCCCTGCTATGTTTCA
GCCTCAGAAATCAAATTTGACAGCCAGGAAGATCTGTGGACCAAAATCATTCTGGCTCGG
GAGAAAAAGGAGGAATCCGAACTGAAGATATCTTCCAGTCCTCCAGAGGACACTCTCATC
AGCCCGAGCTTTTGTTACAACTTAGAGACCAACAGCCTGAACTCAGATGTCAGCAGCGAA
TCCTCTGACAGCTCCGAGGAACTTTCTCCCACGGCCAAGTTTACCTCCGACCCCATTGGC
GAAGTTTTGGTCAGCTCGGGAAAATTGAGCTCCTCTGTCACCTCCACGCCTCCATCTTCT
CCGGAACTGAGCAGGGAACCTTCTCAACTGTGGGGTTGCGTGCCCGGGGAGCTGCCCTCG
CCAGGGAAGGTGCGCAGCGGGACTTCGGGGAAGCCAGGTGACAAGGGAAATGGCGATGCC
TCCCCCGACGGCAGGAGGAGGGTGCACCGGTGCCACTTTAACGGCTGCAGGAAAGTTTAC
ACCAAAAGCTCCCACTTGAAAGCACACCAGCGGACGCACACAGGAGAAAAGCCTTACAGA
TGCTCATGGGAAGGGTGTGAGTGGCGTTTTGCAAGAAGTGATGAGTTAACCAGGCACTTC
CGAAAGCACACCGGGGCCAAGCCTTTTAAATGCTCCCACTGTGACAGGTGTTTTTCCAGG
TCTGACCACCTGGCCCTGCACATGAAGAGGCACCTCTGAGGGAGCAGAGAGGTGGATCCT
GTAGGCTAAAAGGCTTCCAGGCTGAGAGCCGGCCGTGGAAGGAGGGATGCGTGTTCCAGC
CAAAGCATGCCGTTCTGCACCCTACCCAGTTGCCTCCAGGGCCTCTCCTTGGAAGGTCTT
TTGAGGGCTAAAAAGGTCCTGTAAGAAGCGGCATAGCACCCGTGGTGCATGGTATGTGGG
TGACCCTGGACTCGCCACTGGTACCCGCCCTTCCGAGCGGCGCCTAAGCCTTTGCCGTGA
GCATGCACACTGAGAATGCTAATGGTTGGGTTGATTGTATGTTGAGGATCTATTACTGAC
CGTATGATGAGGCCAACTTTTTTTCCTTGTGGTTAGCAAGACTGCAAGAGATGGAAAAAA
AGTAGTTTGAATGTTTTGTGTGTAAGGAGTATACCATGAGATGAGATGACCACCAATCAT
TTCCTTGGGGGGAGGGGGTGTCTGCACCTTAGAAAAAAAAAGAAAAATCAAAAAAACAAA
AAAACAAAAACAAAAAAAGAAGGAAAATCTTGGAGGGTGGGCGTGGGAACTCAGGACCCC
AGAGTGGCGAGTGGTGTGGGGAGGGAGAGCCTCTCTCCCCCTTTTCTGTGTGAGAGGAAC
TCTTAGTGTCTGGTGCAGCTATTAAATGTGCAATGTGTCAAGTAGCTTGTTTTACACGCT
ACAACATAGCTCATTTGTAACCCATTGTATAAGCTGTGTATTTACAAATATAACACAACA
ATTTAACTTTTCCTTAGAATACAAAAAGTCATGCATGGTCTGGGGAACTATATGCTTTTC
CATTTTTAAGTCAGGACTGCAATACTGATTCCAGTTAATGAGCAGCTAAGATCCAATCTG
TCTAATACAGTGACCCCCTAGCCATCCGGGCCTGGCAATATACAATTTTTTTTCCCCTCC
AAGTTTGTAACACTCCCCTTCCAGAAAGGCATTGTGCAACACAGGATTATTTTTAAATGA
TTCTGAATTTGAATTAACTTTTTGGAGAATTCTGTGATGCCCTTAGAAGAAATTGGACAC
GTATTGAGTGTCACAAAGCTGGGGCTGGGAATTGCTGGTCTAATGTTTCATTAGACTTAA
GAACCTAAAATTTTTCTCAGTTGGGTGGATAAAACCACTAACGCTTAGAAACTGTTTTCT
CATGCAGCTATGTTTCTCTTATTTATGCCTTGAGGACTAATTTCTGGTTTTCTAGCTGTT
AATGCACTGTTGACCTTCATAATGGTGCCTTACGCAAGCGATCCCTTCTGTGGGGGTCTC
ATACAGGGGTGTGGGCGATGCATGCTTTATTAAGGCTCTTGTTTCACCTGGCAGTGTACT
GTATCAACGTATAATACAGAAAAAAAATCTCTTTAAGGTCCTCCTTCACAAAGACATAGA
GTGAAACTCCCTTTACATGTCAGTATTTGTTCAACACTTTAGGCAACTTGACTGTCAGTG
TTAAAATGGAAAACAGGAAAATGGAAAAATCTGACCAATTCTGCCACCTTGAGACTTTCA
TATAGACCTTGCACAACAATTGTATAGATCACACACCGGCTGTATTTAATATGTAACATT
TTCACACATATTAAAGATACAGAAGTATTAAAAAACCCCCAATGTTAATGTATTTGCTTA
AAAGGCACAAGTTTCACATATCTGTCTAGCTATCTGTTGGTAATACAGAAAGTATACTAC
TTTTTTAAAAAAGTGGGCAGAATTCTTGTGTATGTATATTTGTGTGTACAGTATGTGTAT
GTGTGTATATATATATATTATATATATAGATAATATATAAATATTTTTTTTAAGGAGAAA
CTAGAATGTTTAGCTAGAAAATTCCACAGCCTGTGAAGAAATATTTCAAAATGGCCATAA
AGGAGGTAAAAATGAAAACCATAACCTAACTTTTATAGAGGCTTTATCTTTAATTTAACG
ATGTGCGGAGGACTTTCTTGCTTGAATCTGTTCCGGGCTGTCTGCTCTGTCCATCAAATG
GGCAGGTCTGGAATGGGGCACCTTCGGCCGTTCAGAAGTGGCCTGAACAGAATGCTGGAA
CCCAGGCTGGACTCGGACACACTAAGGTTTTGATTTTGAATTTCAGCCTTATTAGAAGAT
CTAACCTAAGAGTAAGCTAACCACAGGGATTCTTTTGTAGAACACTTTTTATGCAGATGA
AGCTATTTTTTCCAGCAAGTAGATTCTTCCAGTTTTTCCAAGGAGTAATTTCCCCGAATT
GGCATACCACGGCGTGGACAGCTGATATTTCACCCAGCTGCTGGCTTGTGGGTGTGGCTC
TTTGCTTTATATATATATACACACATGTGAGTCTGGCTGGGCTGGTATTTTGTTTGATCT
TCCTGGAAATGAGCAGTGACTAACGCTCACATAACTGGTTTTTTTTTTATCTGGGCTGAT
GAATACATTTACCTAAGAAACTCATTTCGTTTTACTTAAGAGGGGAAGTGCAGTTTTCTT
TTGGCAGTTCAGAATCCAAGCACTTGATTTGCTGGGTTTGGAAAACTCCTTTTTTGGCCT
TCTATGTGCTTAGCCATAACAATTCCATTAAGCAAGAAGGTAAGCAAAAGACAAAAAAAA
AAAAAGGAAAAAAAAAAACTTGCACTGGCTTGTCTCACTTACGAAACATGTCGGAGCTGT
TTGCCTGGGTGGGGCTGGGTACCGTACCTGTCAATGCCTGTGATTTTCATAATTAGCACG
TACATAAAGAAGTACATTCTGTTCAGGTGATAACTGAGCCTCAATCAAGCAGAAACTTTT
TGCTTGAAATTAAAAAAAAATTTCTATTAGTGAAATTTCTTTTTTTTTTTTTTTTGGAAG
CACCCTGTTATCTAAAGAATCTTTGTAAGATTTTTGTAAAATTTTGTTTTACAAGATTTT
ATTTGAAATTGTTTTTTGCAAGATTGTTATATTTCTGTATGAATGTATTTTTTATTGGAA
TAACATAAAAGAATTCTTATCAGCATCTTGAGTCTGGTTGTTTTTTTTGGGGGAAGGGGG
TTGTTGGAACAGATTCCTCCTGCATTCATCACCCTGGCTTCCTCCTGGGGGCAAATCTTC
ATTGAGCAACCCTGAGAACAACTCACCGACCTCAGCCCCTTCCTCTTTCCACAGCCTGTC
CTGGGAGCTGGAGAGGATGTCAGCGAGCCTGACATTGCCCTCCCTGAATGCATCAAATAC
TCTTCTCCAAGGACTGACAAAAACAACCCCCCGGCTGTGGGCACAGTAGGGAACCATGCC
GGTTTGATCTTCCATTGCTCAAGCCAGGGAATGCATTGCAGAGGCACCTGCACAACGACA
AACTTGAGTGTTTCCCTGCCACTTCTGTGCCTCCACAGCCTGCTCCAGTTCCGCAGCTAG
AGCTGGGCCTACCTTCCCCAGCCAGCCCTGCCACACACCTGGCTGAGGCATGTCTGGGAG
GGGTGGAGGAGGCAGAGGGACTCCAGGCCAGAGGGCTGTTCTCACAACCTCAGCCCACTC
TCAGTCAAGGAGGGCAGAAAATAAAAGATGACATCACTGCCAAAAAAAAAAAAAAAAAA

Protein Sequence

>1316 : length: 283
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQ
EDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELS
PTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTS
GKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWR
FARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL