ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

128869

Name

PIGU

Synonym

CDC91L1|GAB1;phosphatidylinositol glycan anchor biosynthesis, class U;PIGU;phosphatidylinositol glycan anchor biosynthesis, class U

Definition

CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1|GPI transamidase component PIG-U|GPI transamidase subunit|cell division cycle 91-like 1 protein|cell division cycle protein 91-like 1|phosphatidylinositol glycan anchor biosynthesis class U pro

Position

20q11.22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Attachment of GPI anchor to uPAR;PID Reactome;500547

Pathway

Glycosylphosphatidylinositol(GPI)-anchor biosynthesis;KEGG PATHWAY;hsa00563

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

Metabolism of proteins;Reactome;REACT:17015

Disease

Melanoma;NHGRI

External Links

Links to cell senescence gene database

128869

Links to epithelial mesenchymal transition gene database

128869

Links to ovarian cancer gene database

128869

Links to endometrial cancer gene database

128869

Links to iHOP

128869

Sequence Information

Nucleotide Sequence

>128869 : length: 1833
ACGCAGCTTGAGGCGCCCGCTTTCCGTCGCTCCGGCCCGCCTCGCCGCAAGGCTTTCTGG
GAGCCGTAGTCCCCACGTCTGGCCTCTCCGGCGCCAGCGGCAGCGCGCGCCCACCCGCGG
AACTACAGAGCGTGGCGCACAGCGCGCGAGGCTCCTCCGCCTCGCCTTCCCTCCCCGCCC
GCGCGCCCGCCCCAGTTATCATGGCGGCTCCCTTGGTCCTGGTGCTGGTGGTGGCTGTGA
CAGTGCGGGCGGCCTTGTTCCGCTCCAGTCTGGCCGAGTTCATTTCCGAGCGGGTGGAGG
TGGTGTCCCCACTGAGCTCTTGGAAGAGAGTGGTTGAAGGCCTTTCACTGTTGGACTTGG
GAGTATCTCCGTATTCTGGAGCAGTATTTCATGAAACTCCATTAATAATATACCTCTTTC
ATTTCCTAATTGACTATGCTGAATTGGTGTTTATGATAACTGATGCACTCACTGCTATTG
CCCTGTATTTTGCAATCCAGGACTTCAATAAAGTTGTGTTTAAAAAGCAGAAACTCCTCC
TAGAACTGGACCAGTATGCCCCAGATGTGGCCGAACTCATCCGGACCCCTATGGAAATGC
GTTACATCCCTTTGAAAGTGGCCCTGTTCTATCTCTTAAATCCTTACACGATTTTGTCTT
GTGTTGCCAAGTCTACCTGTGCCATCAACAACACCCTCATTGCTTTCTTCATTTTGACTA
CGATAAAAGGCAGTGCTTTCCTCAGTGCTATTTTTCTTGCCTTAGCGACATACCAGTCTC
TGTACCCACTCACCTTGTTTGTCCCAGGACTCCTCTATCTCCTCCAGCGGCAGTACATAC
CTGTGAAAATGAAGAGCAAAGCCTTCTGGATCTTTTCTTGGGAGTATGCCATGATGTATG
TGGGAAGCCTAGTGGTAATCATTTGCCTCTCCTTCTTCCTTCTCAGCTCTTGGGATTTCA
TCCCCGCAGTCTATGGCTTTATACTTTCTGTTCCAGATCTCACTCCAAACATTGGTCTTT
TCTGGTACTTCTTTGCAGAGATGTTTGAGCACTTCAGCCTCTTCTTTGTATGTGTGTTTC
AGATCAACGTCTTCTTCTACACCATCCCCTTAGCCATAAAGCTAAAGGAGCACCCCATCT
TCTTCATGTTTATCCAGATCGCTGTCATCGCCATCTTTAAGTCCTACCCGACAGTGGGGG
ACGTGGCGCTCTACATGGCCTTCTTCCCCGTGTGGAACCATCTCTACAGATTCCTGAGAA
ACATCTTTGTCCTCACCTGCATCATCATCGTCTGTTCCCTGCTCTTCCCTGTCCTGTGGC
ACCTCTGGATTTATGCAGGAAGTGCCAACTCTAATTTCTTTTATGCCATCACACTGACCT
TCAACGTTGGGCAGATCCTGCTCATCTCTGATTACTTCTATGCCTTCCTGCGGCGGGAGT
ACTACCTCACACATGGCCTCTACTTGACCGCCAAGGATGGCACAGAGGCCATGCTCGTGC
TCAAGTAGGCCTGGCTGGCACAGGGCTGCATGGACCTCAGGGGGCTGTGGGGCCAGAAGC
TGGGCCAAGCCCTCCAGCCAGAGTTGCCAGCAGGCGAGTGCTTGGGCAGAAGAGGTTCGA
GTCCAGGGTCACAAGTCTCTGGTACCAAAAGGGACCCATGGCTGACTGACAGCAAGGCCT
ATGGGGAAGAACTGGGAGCTCCCCAACTTGGACCCCCACCTTGTGGCTCTGCACACCAAG
GAGCCCCCTCCCAGACAGGAAGGAGAAGAGGCAGGTGAGCAGGGCTTGTTAGATTGTGGC
TACTTAATAAATGTTTTTTGTTATGAAGTCTAA

Protein Sequence

>128869 : length: 435
MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSG
AVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYA
PDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINNTLIAFFILTTIKGSAF
LSAIFLALATYQSLYPLTLFVPGLLYLLQRQYIPVKMKSKAFWIFSWEYAMMYVGSLVVI
ICLSFFLLSSWDFIPAVYGFILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFY
TIPLAIKLKEHPIFFMFIQIAVIAIFKSYPTVGDVALYMAFFPVWNHLYRFLRNIFVLTC
IIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILLISDYFYAFLRREYYLTHGL
YLTAKDGTEAMLVLK