ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1269

Name

CNR2

Synonym

CB-2|CB2|CX5;cannabinoid receptor 2 (macrophage);CNR2;cannabinoid receptor 2 (macrophage)

Definition

cannabinoid receptor 2|testis-dominant CNR2 isoform CB2

Position

1p36.11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080

Pathway

metabolism of anandamide an endogenous cannabinoid;PID BioCarta;100217

Disease

METABOLIC;GAD

Disease

bone density;GAD

Disease

CARDIOVASCULAR;GAD

Disease

blood pressure, arterial hypertension;GAD

Disease

Osteoporosis;GAD

External Links

Links to cell senescence gene database

1269

Links to epithelial mesenchymal transition gene database

1269

Links to ovarian cancer gene database

1269

Links to endometrial cancer gene database

1269

Links to iHOP

1269

Sequence Information

Nucleotide Sequence

>1269 : length: 2835
GCGTGAGCCACCGCGCCTGGCCTTTTTTCTTTTTTAATCAGGCAGCCCAGAATAGGTTCA
GAAAGACTCCCGCTTCTCTTTTACTCTTACATCTGTACAGCATCAGGTCACAAAATGTTT
TTGCATGCATCGGTGATTCTTAATATTCAGAACTCTGCTGGCACACTGATAAAAAGTGTG
AATCCTTCTACCCCAACCAAAACATGCACAGACATAAAGTCTTAAATATGCCTCGAAAGG
ACCGATACTCCCATCCAAGCCTACCCATGGACCCAGGGTAAGAAGCTATGATGGAGGTCA
TCAGCCCATTTGGCATCTCAAGGAGAATGGCATAGTTGATGGACATTTAGAATTGTTCTT
CTATTTCAAAAATGCCAAAGAGAACATTCTTGTACATGCCTCCCTGGACGCACCTGCAGG
AGTTCCTCCAGAACGTATTCCCGGGACTGCAATTGATGTATCGTCAACTTCACCAGATTT
TGCCAAGCTGCTCTTCAAAGTGTCTGTGTCAACTTACACCCCCATCGCAATGAGAGTTCT
TTTGGCTCCACGCCTTCTCCAGCACTCAGTATTGTCAGCCTTACTTTTTTACCGATCTGA
TGGGAGTGAAACACATTTCTCTGTCTACTATTGAGCAAAGCCTTCTAGACAAGCTCAGTG
GAATCTGAAGGGCCCACCCCATGGAGGAATGCTGGGTGACAGAGATAGCCAATGGCTCCA
AGGATGGCTTGGATTCCAACCCTATGAAGGATTACATGATCCTGAGTGGTCCCCAGAAGA
CAGCTGTTGCTGTGTTGTGCACTCTTCTGGGCCTGCTAAGTGCCCTGGAGAACGTGGCTG
TGCTCTATCTGATCCTGTCCTCCCACCAACTCCGCCGGAAGCCCTCATACCTGTTCATTG
GCAGCTTGGCTGGGGCTGACTTCCTGGCCAGTGTGGTCTTTGCATGCAGCTTTGTGAATT
TCCATGTTTTCCATGGTGTGGATTCCAAGGCTGTCTTCCTGCTGAAGATTGGCAGCGTGA
CTATGACCTTCACAGCCTCTGTGGGTAGCCTCCTGCTGACCGCCATTGACCGATACCTCT
GCCTGCGCTATCCACCTTCCTACAAAGCTCTGCTCACCCGTGGAAGGGCACTGGTGACCC
TGGGCATCATGTGGGTCCTCTCAGCACTAGTCTCCTACCTGCCCCTCATGGGATGGACTT
GCTGTCCCAGGCCCTGCTCTGAGCTTTTCCCACTGATCCCCAATGACTACCTGCTGAGCT
GGCTCCTGTTCATCGCCTTCCTCTTTTCCGGAATCATCTACACCTATGGGCATGTTCTCT
GGAAGGCCCATCAGCATGTGGCCAGCTTGTCTGGCCACCAGGACAGGCAGGTGCCAGGAA
TGGCCCGAATGAGGCTGGATGTGAGGTTGGCCAAGACCCTAGGGCTAGTGTTGGCTGTGC
TCCTCATCTGTTGGTTCCCAGTGCTGGCCCTCATGGCCCACAGCCTGGCCACTACGCTCA
GTGACCAGGTCAAGAAGGCCTTTGCTTTCTGCTCCATGCTGTGCCTCATCAACTCCATGG
TCAACCCTGTCATCTATGCTCTACGGAGTGGAGAGATCCGCTCCTCTGCCCATCACTGCC
TGGCTCACTGGAAGAAGTGTGTGAGGGGCCTTGGGTCAGAGGCAAAAGAAGAAGCCCCGA
GATCCTCAGTCACCGAGACAGAGGCTGATGGGAAAATCACTCCGTGGCCAGATTCCAGAG
ATCTAGACCTCTCTGATTGCTGATGAGGCCTCTTCCCAATTTAAACAACTCAAGTCAGAA
ATCAGTTCACTCCCTGGAAGAGAGAGAGGGGTCTTGGCACTCTCTTCTTACTTAAACCAG
TCCCAGACACCTAGACACGGACCCCTTTTTGCTGATGAGTGTTGGGACTGACTCCTGGAA
GACAGCCTGGCCTTGCCCACCTGCACACAGTCTGTTGGATAGGTAGGGCCACGAGGAGTA
GCCAGGTAGGCGAGACACAAAAGGCCTGGGACAGGGTCAGTACAAGTCAGGTCAGGCTTC
ATGCCTGCATCCTCCAGAGACCACAGGAGCCAAAGCGAGCCTCCAGGCCCAGCAATGAGG
GACTTGGGAGAAATCTGAGAAGAATGGGTTGTTCTCTTGGGAAGTCAGGGTATCAGATGG
GATGGACATCCAGGTCTTCTCTCTGCCTAATTGTCAAGGCCTCCTTGGCTCTGGAGCTAT
GAAAGGCCCCACTTTCAAGTCACCCTTGCCACTGAGGACCGAGGACTATGCTATGATGAG
GATTAAGGTGTTGACTTGCCTCTTTCAGAGATAAATGACAAGCCTTCAGTTTGGGGCATC
CTGTTGTTTGGGCGAGGACCCTCTCTGATATTCTGATAATCCCCACCTGTAACCTCAGGT
CCCTGGAAATACAGAGGAGGCTGGGATCGCCTGAGACACAAAAATCTTTGGAGAATTTTC
TTGACCCTCTGAAGTCCTTCCAGCAGCAGTCCTGGTGGTGCTGCTGGAAGCAGGCAATGT
CCTAGTCTAACCTAACTCGAAGAAAAAAAGGAAGATATTCACAAAGATTGTATAAATCTC
CAAACTGTTCCCCTATCTGCCCCCAATTCAGCTCCCTTGCCTCCTCCACACCCCTATTAC
ATATAATAAGCAGAGCAAGTGGGAGGAGGGGAAATGTCCTTCCTATATGCCAGGTATGGG
GCTGACATTTCAGTCTATTGACCCCAGCTAGAATATAGCTCCATGATTTTAAAGATCTCA
GGGGCCAGGCATGGTAGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCAAGGCAGGTG
GATCACCTGAGGTCA

Protein Sequence

>1269 : length: 360
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC