ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

117159

Name

DCD

Synonym

AIDD|DCD-1|DSEP|HCAP|PIF;dermcidin;DCD;dermcidin

Definition

diffusible survival/evasion peptide|preproteolysin|proteolysis inducing factor|survival promoting peptide

Position

12q13.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

117159

Links to epithelial mesenchymal transition gene database

117159

Links to ovarian cancer gene database

117159

Links to endometrial cancer gene database

117159

Links to iHOP

117159

Sequence Information

Nucleotide Sequence

>117159 : length: 709
CAGCCAGCCTTTGTTGACTTAACAGGTGGCTCTGAGGTGGGAGAAGAGGAGGAGGAGAAC
ACACCACTGGAAGACTGGTTCCCATTGGTCCCTGTCATGCTTAAAAAAAGGCCCAGAGAG
GCAGTCTTGACACCCTAGATCCCAAGATCTCCAAGGATTTGGTGGCATACCCACTCCAGC
ACACAGAAGCATGAGGTTCATGACTCTCCTCTTCCTGACAGCTCTGGCAGGAGCCCTGGT
CTGTGCCTATGATCCAGAGGCCGCCTCTGCCCCAGGATCGGGGAACCCTTGCCATGAAGC
ATCAGCAGCTCAAAAGGAAAATGCAGGTGAAGACCCAGGGTTAGCCAGACAGGCACCAAA
GCCAAGGAAGCAGAGATCCAGCCTTCTGGAAAAAGGCCTAGACGGAGCAAAAAAAGCTGT
GGGGGGACTCGGAAAACTAGGAAAAGATGCAGTCGAAGATCTAGAAAGCGTGGGTAAAGG
TGGGGAAGAGAGGTTGGTCTTTGGGGCTCCTGTGAATCTAACCTCCATCCCTCTGACTTC
TGTGAGCCGTCCATGACGTTAAAGACGTCCTTGACTCAGTACTATAGCTGTAAGGAGAAG
CTGAGAAATGATACCCAGGAGCAGCAGGCTTTACGTCTTCAGCCTAAAACCTAAAAAAAA
AAAAAAAAAAAAAAATTTAAAACAGCTATTAAACTGAAAGCATCTGTAA

Protein Sequence

>117159 : length: 121
MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRK
QRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGGEERLVFGAPVNLTSIPLTSVSR
P