ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

116986

Name

AGAP2

Synonym

CENTG1|GGAP2|PIKE;ArfGAP with GTPase domain, ankyrin repeat and PH domain 2;AGAP2;ArfGAP with GTPase domain, ankyrin repeat and PH domain 2

Definition

Arf GAP with GTP-binding protein-like, ANK repeat and PH domains 2|GTP-binding and GTPase activating protein 2|arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2|centaurin, gamma 1|cnt-g1|phosphatidylinositol 3-kinase enhancer|phosphatidyl

Position

12q14.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Netrin-1 signaling;PID Reactome;500088

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Netrin-mediated signaling;PID Curated;200074

External Links

Links to cell senescence gene database

116986

Links to epithelial mesenchymal transition gene database

116986

Links to ovarian cancer gene database

116986

Links to endometrial cancer gene database

116986

Links to iHOP

116986

Sequence Information

Nucleotide Sequence

>116986 : length: 6444
CAGCGGAGCCGGGCCGGGGGCTCAGCGGGGTCCGGGGGCTGGGGGCAGCGAGCAGGGCGG
CCCCATGGCCGGGCCCCCCTGAGGCAGTCCGGGGGAGTCCCCTCCCCTCCCCAGCTCGGG
GGTCTCCGGGCCCCATGAGCCGGGGCGCGGGCGCGCTTCAGCGCCGGACAACGACCTACC
TCATCTCGCTGACCCTGGTTAAGCTCGAGTCGGTGCCTCCGCCGCCGCCTTCTCCGTCTG
CGGCCGCGGCCGGCGCCGCCGGTGCCAGAGGCTCCGAGACTGGGGATCCTGGCAGCCCCC
GAGGCGCGGAGGAGCCGGGCAAGAAGCGGCACGAACGTCTCTTCCACCGGCAGGATGCGC
TGTGGATCAGCACGAGCAGCGCGGGCACCGGGGGCGCGGAGCCCCCAGCCCTGTCCCCGG
CTCCGGCCAGTCCGGCCCGCCCAGTCTCCCCCGCTCCCGGCCGCCGCCTCTCCCTCTGGG
CCGTCCCTCCGGGACCCCCGCTCTCCGGGGGACTGAGCCCCGACCCCAAGCCTGGGGGCG
CCCCCACCTCCTCCCGGCGCCCCCTGCTCAGCAGCCCGAGCTGGGGCGGCCCGGAGCCCG
AAGGCCGGGCGGGCGGCGGCATCCCTGGCTCATCCTCTCCGCACCCTGGCACCGGCAGCC
GGAGGCTCAAGGTGGCGCCTCCTCCGCCGGCTCCCAAGCCTTGCAAGACCGTGACCACGA
GTGGAGCCAAAGCCGGCGGGGGCAAGGGCGCGGGTAGCCGCCTGTCATGGCCCGAAAGCG
AGGGCAAGCCCAGGGTCAAGGGGTCAAAGAGCAGCGCCGGGACTGGAGCTTCGGTCTCTG
CCGCCGCCACCGCCGCCGCCGCCGGGGGAGGGGGCTCTACAGCTTCGACCTCTGGTGGGG
TCGGGGCTGGGGCTGGAGCCCGAGGGAAGTTGTCCCCTCGGAAAGGCAAGAGTAAGACCT
TGGACAACAGTGACTTGCATCCGGGACCGCCTGCCGGCTCTCCTCCTCCGCTAACCCTCC
CACCAACTCCGAGTCCAGCCACTGCTGTCACCGCTGCTTCCGCGCAGCCCCCCGGGCCTG
CACCTCCAATCACTCTGGAGCCTCCAGCTCCGGGGCTGAAACGGGGCCGGGAGGGGGGCC
GAGCATCCACTCGTGACCGCAAGATGCTCAAGTTTATCAGCGGCATCTTCACCAAGAGCA
CAGGAGGGCCTCCTGGCTCCGGGCCCCTTCCCGGACCCCCCAGCCTGTCTTCTGGCAGCG
GGTCCAGGGAGCTGCTGGGCGCCGAGCTCCGCGCTTCCCCTAAGGCTGTGATCAATAGCC
AGGAATGGACTTTGAGCCGCTCCATTCCTGAACTGCGCCTGGGTGTGCTGGGCGATGCCA
GGAGTGGGAAGTCATCGCTCATCCACCGATTCCTGACTGGCTCATACCAGGTGCTGGAGA
AGACAGAGAGTGAGCAGTACAAGAAAGAAATGTTGGTGGATGGACAGACACATCTGGTGC
TAATCCGAGAGGAAGCTGGGGCACCTGATGCCAAGTTCTCAGGCTGGGCAGATGCTGTGA
TCTTCGTCTTCAGCCTGGAGGATGAGAACAGTTTCCAGGCTGTGAGCCGTCTCCATGGGC
AGCTGAGTTCCCTTCGCGGGGAGGGACGAGGAGGCCTGGCCTTGGCACTGGTGGGGACAC
AAGACAGGATCAGTGCTTCCTCCCCTCGGGTGGTGGGAGATGCTCGTGCCAGAGCTCTGT
GCGCGGACATGAAACGCTGCAGCTACTATGAGACTTGTGCAACCTATGGGCTCAATGTGG
ATCGGGTCTTCCAGGAGGTGGCCCAGAAGGTGGTGACCTTGCGCAAGCAGCAACAGCTTC
TGGCTGCCTGCAAGTCCCTGCCCAGCTCCCCAAGCCACTCAGCTGCATCCACTCCGGTAG
CTGGCCAGGCTAGTAACGGGGGCCACACTAGCGACTACTCTTCTTCCCTCCCGTCCTCAC
CGAATGTTGGTCACCGGGAGCTCCGAGCCGAGGCAGCTGCAGTGGCTGGATTGAGCACCC
CAGGGTCCCTGCACCGGGCAGCCAAGCGCAGGACCAGCCTTTTTGCGAATCGTCGGGGTA
GTGACTCCGAGAAACGAAGCTTGGATAGTCGGGGAGAGACAACAGGGAGTGGGCGAGCCA
TCCCCATCAAACAGAGCTTCCTACTAAAACGAAGTGGCAATTCCTTGAACAAAGAATGGA
AGAAGAAATATGTAACCCTGTCCAGTAATGGCTTTCTACTCTACCACCCCAGTATTAACG
ATTACATCCACAGTACCCACGGCAAGGAGATGGACTTGCTGCGAACAACAGTCAAAGTCC
CGGGCAAGCGGCCCCCGAGGGCCATCTCTGCCTTTGGCCCCTCAGCCAGCATTAACGGGC
TCGTCAAGGACATGAGCACTGTCCAGATGGGTGAAGGCCTGGAAGCCACTACTCCCATGC
CAAGCCCTAGCCCCAGCCCCAGTTCCCTGCAGCCACCACCAGATCAGACATCCAAACACC
TGCTGAAGCCAGACCGGAATTTGGCCCGAGCCCTCAGCACGGACTGTACCCCATCTGGAG
ACCTGAGCCCCCTGAGTCGGGAACCCCCTCCTTCTCCCATGGTGAAGAAGCAGAGGAGGA
AAAAATTGACAACACCATCCAAGACTGAAGGCTCGGCTGGGCAGGCTGAAGAGGAAAACT
TTGAGTTCCTGATCGTGTCCAGCACGGGTCAGACGTGGCACTTTGAGGCAGCCAGTTTTG
AGGAGCGGGATGCCTGGGTCCAGGCCATCGAGAGTCAGATCCTAGCCAGTCTGCAATGCT
GTGAGAGCAGCAAGGTCAAGCTGCGCACAGACAGCCAAAGCGAGGCCGTGGCCATCCAGG
CGATCCGGAACGCCAAGGGGAATTCAATCTGCGTGGACTGCGGGGCCCCCAACCCCACGT
GGGCCAGCTTGAACCTGGGCGCCCTCATCTGCATCGAGTGTTCTGGCATCCACCGCAACC
TGGGCACACACCTGTCCCGCGTTCGCTCGCTGGACTTGGACGACTGGCCACGGGAGCTGA
CCCTGGTGCTGACGGCTATTGGCAACGACACGGCCAACCGCGTGTGGGAAAGCGACACGC
GAGGCCGTGCCAAGCCCTCGCGGGACTCTTCGCGGGAGGAGCGCGAGTCGTGGATTCGCG
CCAAGTACGAGCAGCTACTGTTCCTGGCGCCGCTGAGCACCTCGGAGGAGCCGCTGGGCC
GCCAGCTGTGGGCCGCCGTGCAGGCCCAGGACGTGGCTACCGTTCTCCTGCTTTTGGCCC
ATGCGCGACACGGGCCGCTCGACACCAGCGTAGAGGACCCACAGCTGCGCTCCCCACTCC
ACCTGGCGGCCGAGCTCGCCCACGTCGTCATCACGCAACTGCTGCTGTGGTACGGCGCGG
ACGTGGCGGCCCGTGACGCCCAGGGCCGCACGGCGCTGTTCTACGCCCGCCAGGCTGGAA
GCCAGCTGTGCGCCGACATCCTTCTCCAGCACGGCTGCCCGGGTGAGGGCGGCAGCGCGG
CCACCACGCCCAGCGCGGCCACCACGCCCAGCATCACCGCCACGCCCAGCCCCCGCCGCC
GGAGCAGCGCCGCTAGCGTGGGCCGCGCCGACGCCCCGGTTGCGCTGGTATAGTTGCCCA
GCGGGAGAGACACCCCCATCCCCACGCGGGCCGGGCACGACCACACCGGGCGGACCGCTG
GACAGACGCACCCACTCACCTCTCCGATCCGCACCCCGCCCCACGGGAGCACTTCCTACC
CCCACGAGGGCACAGCCCCCACGCCTTCCAGAAGACACAAACTCACCTCCCTCTCCCCAA
CGAGGCATGGAGACCCCAGCTCAACACGCCCCCTCTCCATTGTTTCCACACTCGGATTGC
TCTGGGTCTACCCGCTCGGGGTTCGCGGAAGGGGAGGTCCCCAGCGGTACGGGCTCCTAG
GCGCTTGGACATGCCCGCTTGTGCCCCCTAGGGGCGGAAAGAAGACCCGGTCCTGCCCGA
GCTCAACAATCCCAGGGCGGGAGCCCATACCCAGGCTGGCTCCTGGGGCGACGCCACGCC
AGAGGGAGGGTTTAGTACATGGGAGGGCTAGCCCCGGGACTTGGGGCCAATACGGAAACC
CTACCCCTTCCATGCTCATCTCACTGCCCAGTGAAGGGGGCAAGGGCAGCGAGGGGCAGG
ACCCCTGCTGCTCATGGGGGTGGGGGTTCCCAACCCTTTCCGTGAAAGGGACCGTGAGTA
GTGGAAACCAGGACGTCCCCTACACCTACCCATGGGTGGAAGCTAAAGAGTCCGGGGGGA
ACCAAGAGCCTGGGTCCCTCCCACTACTATCTTGGGAGGGAGAAGGGATGGAGCAGGAGC
GGGCTAAGAGGGCTGCGGGGGCCTTGTAATTTATTGCTTTGTTCCCCAACATGGGGATGG
GGGCGGGCAGGGGCGTGGGGAGGGCGTTTTGGGGTAGGGGAAGCCCAGGGTGGGCAGGGG
GTGGGTTGGGGTGGGGGTGCTCTCGGGTTGTGTCTGTGACCGTGACTGCGTACCTGTGAC
TGTGCAGCGCCCGTGGTGATCTGGGGTAGGGGGCACCCCTACAGTGGGACCCCTCCCCCA
TTATTCTTTCTGTCCAGCCCCTCCCTCCCACTGGAGCAGCTCCAGAGCCATTCCTCACCC
CCGTGACCTCTCCCAGCCAGGGCTGAGAGGATTCGAGGTGGCTGGGAGGGTTTCCAGGCC
CCCTGCCCCTTCCCCACAAACTGGGTGATAGGGCGGACTTACCTGGCCCAGCCCTGCCTC
CCTCAGCCAACCCAGCCCTTGGGCTGTCTGTGTCAGTGGTTTCCGGTCTTTTTTTTTTTT
TTTTTTTCTGGCTAAAATAGTTTGCAAAGGACCAGGTAATTGGGGAGGGGAGAGAGGTGG
GGGCAAGGGGGAAATGCCCCCCCATCTCCTTGGAGGCAGTGGTGTGAATCTTCTTCAACA
GCAATTAAAGAGGAAGTGATTTTGTCTAGGGGGTGAGCTGCTGGTCTGTTCTTGGAGGCA
GGTCAGGGCATGGCCTTGGTCAAGATGGGGTACTGGGGTTGGACAGGGACAGGCAGAGGT
GCCTCCCACTGGGGCTGGTGGCAGGACAGTACCCATGGGCATGGAGGTGGTTCCATCATG
TACAACAGTTCTGGGTTCATGTAGTGGAGGACGTGGGCAGGTTGGAGTCAGTGGGGACCC
TGGGAACAGAGAAGGCACTGACTCTTAAGATGATGCCAGTCCTGGGAGAGTTGGGATATG
GTACTTAGAGGAGAGGACAGGCCCATGGAGAGGGGTGGGAAGATGGGACAGCTTTGTTTA
AGAGCAGGAACTTTGGAGACAGATCTGATTTTGAAACCTGCCCCTCCACTGCACAGCTAG
GGGACCTTGGTGGCATCTGTTTATCTGTATTCTGAACAGTATCTGTTCAGAGGGCACCTG
AAAGGCGCTCCAGCTCTGAGGAGGGCTGCCCCGAGCCAGCCTGCTCACCGTGAGCACTAG
GTACCAGAGTAGAACATAGAGTAGGGGTTCCTCCCCTGGCCTCGTCAGGGGGTGTTCCAG
AGGGAAGGGGTGGGAGACCTCCTGGGAAAGATTTCCCAGCTAGCTGCAGAGGTCCCTGGT
GTCCACAAACTCAGTGTCAGCTGATGCAGGCATTTATCCACCTCCGTGCCATCAAAGGGA
CCACCAAGGCCACAGCGGCCTGAAGCCGGTGCTGCCTCCATGAGCTGCAGTGCCACTAGG
CTCAGCACATAGCCAATCCTACCATTTCTCGAGGGCAGCTGAAAGTGTTTACTCAGGTAG
AGGGGCTGGACAGGGTAGGGTTGGGTCAGCAGCCAGTGCAGGTTGGGCACAGCCATATGT
TGTTATCTACCTTGAGGAGTTAGTTGGTAGCACCAGCATCTTTGGGTAGAATTGCTTCTG
ACCCTTGGTGCCCACCAGCCCCAAGAGGTTCAGCTGCAAGTGTGCCACTGAACTGAGGAC
ACAGCACCAGACCTGAATCCAGTTCACATGGAGGCTGCGGCTCTACAGGGTCCTAGGCTG
TGACCACCCAGCACAGCGGCGTGACCCAGGAAAGGTGGATTCAACAGTGCAGGTGCAGTG
ACAAGTACAGAGGCAGGTGTGTGGTCTGGGCAAAGCGACAAGAGGGGGGAGGTAGCAAAG
AAGATTGGACTAGAGGACCTGGCCGTTCCCCCTTCACCTCCAAGACCCTGGACTCTCTTA
TTTCAGCTCCACTCCTTCCTCGTGGCCAAAGTTTGCTCCCTTCTTCAGAAGTTTGGGAGT
GTGAGAGAATATGGGAAGGAAATAAGGACCCTGGAGAGAATGAAATTGCCTTCAAAGAGC
AAGTGGGAAGTTCCTTTCATTTCCAGCCAGTGAAAAATGGTCAAGGTGTCAGCAAACCTC
ACAACAAATCCCAACACCAAGTAA

Protein Sequence

>116986 : length: 1192
MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAAGAAGARGSETGDPGSPRGAEE
PGKKRHERLFHRQDALWISTSSAGTGGAEPPALSPAPASPARPVSPAPGRRLSLWAVPPG
PPLSGGLSPDPKPGGAPTSSRRPLLSSPSWGGPEPEGRAGGGIPGSSSPHPGTGSRRLKV
APPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASVSAAATA
AAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPPTPS
PATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPP
GSGPLPGPPSLSSGSGSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKS
SLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFS
LEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMK
RCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQAS
NGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEK
RSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHS
THGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLEATTPMPSPSP
SPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTT
PSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDA
WVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLN
LGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAK
PSRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGRQLWAAVQAQDVATVLLLLAHARHG
PLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCA
DILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVALV