ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

114757

Name

CYGB

Synonym

HGB|STAP;cytoglobin;CYGB;cytoglobin

Definition

histoglobin|stellate cell activation-associated protein

Position

17q25

Gene Type

protein-coding

External Links

Links to cell senescence gene database

114757

Links to epithelial mesenchymal transition gene database

114757

Links to ovarian cancer gene database

114757

Links to endometrial cancer gene database

114757

Links to iHOP

114757

Sequence Information

Nucleotide Sequence

>114757 : length: 2528
AGTGGAGGGTCCGGAGTGGGAAACCAGGCCTGTGAAGAACCACGGCTGTCAGAAAACGAA
GCTGGAGGTTCACTTCTGCCAGAAAGTCATTGAGCTTCAACACAGTTTGTCCCTGGTCGA
GACTGGGGAAGCACAGAAAGTTCGAGGGGGCAGGGACAGATGAGGAAACCGGGGCTTGGC
CGAGTATCTTTGTTAATTGCTCTGCGGATTTTATTTGGGGGAGGATAGGGGCATTTGGGG
TGGTTCGCTGGGTTAGTGAAGAGGAGAGATTCCGAGGGAATCGTTCAACCTCCTGCTCAG
GTGTTTTTAAGTTTGGGGCGAGGCCGGTGAAGCCGAGGCGCGGGCGGCAAGGAGCGCTGG
AGAGCGACGGGGCTCGGCCTCCGCGGCTGCCCAGGGGCCCGGGGCATTCCGAGAAGAGAA
AAAAAGCTTGTACTTAAATACTTCCTGCGAAGTTTTGACTGAGACGCTGCAACAATTCCC
GAGCTGTTTCATCGTGGCACCTTCCTGGTGGCAGGTGGATTAGCACATTGTCTGCAACCC
AGGAGGACTTGGAGGAAAGTCCCAGCTCTGCTGATTCTAGCTGAGTAACCTTGGCAAAGG
TCACCTCACTTCTCTCTGAGTCTTATTTTCTCATCTGTAAAATGAGGAGGAGGAGGAGGA
TCATCCAAACATCACGGGACTTCGTTAAATCAGTGCTTCGGGGCACTTAGCACAGCGCCT
GGCGCAAGGTTCTTTGTGAACTTCCCCTCGGCCAAGCAGTACTTCAGCCAGTTCAAGCAC
ATGGAGGATCCCCTGGAGATGGAGCGGAGCCCCCAGCTGCGGAAGCACGCCTGCCGAGTC
ATGGGGGCCCTCAACACTGTCGTGGAGAACCTGCATGACCCCGACAAGGTGTCCTCTGTG
CTCGCCCTTGTGGGGAAAGCCCACGCCCTCAAGCACAAGGTGGAACCGGTGTACTTCAAG
ATCCTCTCTGGGGTCATTCTGGAGGTGGTCGCCGAGGAATTTGCCAGTGACTTCCCACCT
GAGACGCAGAGAGCCTGGGCCAAGCTGCGTGGCCTCATCTACAGCCACGTGACCGCTGCC
TACAAGGAAGTGGGCTGGGTGCAGCAGGTCCCCAACGCCACCACGCACAGCTCCTGGAGG
AGGTCCCCTGAGGGCAGCTGGGGACGCCAGGCCTCCTGCCCTTCCTGCTGCTGACCACAC
TGGCCCCGGGCTGGCTCCTGCTCCCCTCCCCCCTCTCCCGTCAGCACCACCCCAAGAGAG
TGGAGTCCTCGGGAACTGCTGGCTGGAGCCAAGCCAACTCCAGATGTGCACAGCTGGGCC
CTGGCCTGCCTGAGACCTGGGAGTCAATGGGAAACAAGCAGATGTTGGCCCACCAGAGGA
GGGCACTGGCAGGGCGTGGAGAGCAGTGGTTGCCCCCTCACCCCCCACCAGCTGTCACCC
AGAGGGTCCAGGGAAAAGACAGGGGAAGAGGAGGGGAGGGGGCTTGCCTGCCCTCCCACC
CCTCTCCCCACGCAGGCTCTGCTGCCAAAGATGAGTTTGTTTACAGCCAGGACACAAGAC
TTCCTGCTTCCAGAGAAAAGGGCTTTTTTACAAGGGCCAAGAGAGACTGGAAAGAGAGCT
GGCTGGGCGCGAGCCCCAGTGAATCAGAAACACATGGCCCAAGTTCCCCAGCACGCTGCC
CGTCCTGCCCTCCCCACCCTGCCCTAGGGACTAAGATCTCTCCAAACCCCAAACATTTTG
AAACGGCCGAAGTCTCCTCCTCCGCCCACTTCTGCTCCTTGTGGACTGAATGGAGATGGG
CTACCGTGGAAACTGGCACCCCATGGGGGTTACTCCCAGCTGTCAAGTGGTGGGGTGGTC
CCCTCATCCCTTTACACCCTCTAGCCCACCCCTAGTGTCCCTGGCCTGAGCCTGCAGAGC
CTCCCTGCTGCCAGGGTCCCCATGGGCTCGAGGGTAGGATGGAGTTACAGAGTAGAGTCC
TAGAAGGCCCTCGCCCAACTTCTCTTATCAGGGAAGCAGGGGTGGGCCAGGCGCCACTGT
TTATTGAGCCGTCTCTGCTCCAGGGTGTGCGCCTTTGCGTGGGTGGGGGGTGGGGGGGGG
GCGCAATGACTGCAGGGGGCGCTGTGTGTACCGAGAATACGAGAATACAGATGGGTGGCC
CGAGGAGGGACGAGACAGGCCGGACAGAATGCGCCACGTTTCAGAATTAATGGAAAAAGA
GCTCACATTGGTATCGTGCTTTGCAGTTTGTGAAACACTTTTTTACCCAGTTTATGTCAC
AAGACAGACATTATTCACATTTTAGAGAAAAAGATCCGGAGCTCCCATGGGCCAGTAGAC
TTGCCTGAGATCACACAGCACGTTCGTAGCAGGACGGAGACTAGAACTTGGGTCTCACGG
TTGCTTTCAACTGCACTGTGCCGGATCTCTTGGCAGGAAGTGAGCCTCGCCAGCCCCAGG
TCCTCCCCCTTTCCCCCGAGGGTCCTTCCCTGCCTCTGGTAACGTTTGTCCTTCCCTTCC
TATCTCGT

Protein Sequence

>114757 : length: 202
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
HSSWRRSPEGSWGRQASCPSCC