ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11315

Name

PARK7

Synonym

DJ-1|DJ1|HEL-S-67p;parkinson protein 7;PARK7;parkinson protein 7

Definition

Parkinson disease (autosomal recessive, early onset) 7|epididymis secretory sperm binding protein Li 67p|oncogene DJ1|protein DJ-1|protein deglycase DJ-1

Position

1p36.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Parkinson's disease;KEGG PATHWAY;hsa05012

Pathway

Alpha-synuclein signaling;PID Curated;200187

Disease

Amyotrophic lateral sclerosis;FunDO

Disease

Parkinson's disease;KEGG DISEASE;H00057

Disease

Embryoma;FunDO

Disease

Celiac Disease;GAD

Disease

IMMUNE;GAD

Disease

Amyotrophic lateral sclerosis-Parkinsonism/dementia complex 2;OMIM

Disease

Neurodegenerative disorder;FunDO

Disease

Polyneuropathy;FunDO

Disease

Parkinson disease 7, autosomal recessive early-onset;OMIM

Disease

Thyroid cancer;FunDO

Disease

Intraocular melanoma;FunDO

Disease

Amyloidosis;FunDO

Disease

Nervous system diseases;KEGG DISEASE

Disease

Neurodegenerative diseases;KEGG DISEASE

Disease

Celiac disease;NHGRI

Disease

Malignant glioma;FunDO

Disease

Chronic obstructive airway disease;FunDO

Disease

Parkinson disease;FunDO

External Links

Links to cell senescence gene database

11315

Links to epithelial mesenchymal transition gene database

11315

Links to ovarian cancer gene database

11315

Links to endometrial cancer gene database

11315

Links to iHOP

11315

Sequence Information

Nucleotide Sequence

>11315 : length: 982
CGCCCTCGCTTCCGGCCTCCCAGTCGGGCCCTGTCGCTGGCGTTGGATTTGACTGACCGC
CAGCGTGGTGGCAACGCTGAAGCGTCCAGAATCTTCTGCCTAACCTCTCGCCGGCATGGA
ACTGGCTAGCCGTTTTATTAAACTCTGTTTTGCGTGGACGGCTTGTAAACATATAACATA
AAAATGGCTTCCAAAAGAGCTCTGGTCATCCTGGCTAAAGGAGCAGAGGAAATGGAGACG
GTCATCCCTGTAGATGTCATGAGGCGAGCTGGGATTAAGGTCACCGTTGCAGGCCTGGCT
GGAAAAGACCCAGTACAGTGTAGCCGTGATGTGGTCATTTGTCCTGATGCCAGCCTTGAA
GATGCAAAAAAAGAGGGACCATATGATGTGGTGGTTCTACCAGGAGGTAATCTGGGCGCA
CAGAATTTATCTGAGTCTGCTGCTGTGAAGGAGATACTGAAGGAGCAGGAAAACCGGAAG
GGCCTGATAGCCGCCATCTGTGCAGGTCCTACTGCTCTGTTGGCTCATGAAATAGGTTTT
GGAAGTAAAGTTACAACACACCCTCTTGCTAAAGACAAAATGATGAATGGAGGTCATTAC
ACCTACTCTGAGAATCGTGTGGAAAAAGACGGCCTGATTCTTACAAGCCGGGGGCCTGGG
ACCAGCTTCGAGTTTGCGCTTGCAATTGTTGAAGCCCTGAATGGCAAGGAGGTGGCGGCT
CAAGTGAAGGCTCCACTTGTTCTTAAAGACTAGAGCAGCGAACTGCGACGATCACTTAGA
GAAACAGGCCGTTAGGAATCCATTCTCACTGTGTTCGCTCTAAACAAAACAGTGGTAGGT
TAATGTGTTCAGAAGTCGCTGTCCTTACTACTTTTGCGGAAGTATGGAAGTCACAACTAC
ACAGAGATTTCTCAGCCTACAAATTGTGTCTATACATTTCTAAGCCTTGTTTGCAGAATA
AACAGGGCATTTAGCAAACTAC

Protein Sequence

>11315 : length: 189
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ
VKAPLVLKD