ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11279

Name

KLF8

Synonym

BKLF3|ZNF741;Kruppel-like factor 8;KLF8;Kruppel-like factor 8

Definition

Krueppel-like factor 8|basic krueppel-like factor 3|basic kruppel-like factor 3|zinc finger protein 741

Position

Xp11.21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Disease

Embryoma;FunDO

Disease

Mental retardation;FunDO

Disease

Breast cancer;FunDO

Disease

Ovarian cancer;FunDO

External Links

Links to cell senescence gene database

11279

Links to epithelial mesenchymal transition gene database

11279

Links to ovarian cancer gene database

11279

Links to endometrial cancer gene database

11279

Links to iHOP

11279

Sequence Information

Nucleotide Sequence

>11279 : length: 8952
ACTTTGCACTCTCCTCTAGCGGCCGCCTGTCCTTTTTAAGGAACTCCACCCTAGGTGGAG
TCCTCACGATAGTCACACCTCTCCTTTGGGCCTAGCAGGGCCAGAGAAAGACGGAATCAC
TCTACCCACTCAGGTTGCCCAGAGAGCACTTTAGGTTCTGACTCGCGTGGGGCGCGAGGT
ACCCCGTGGGGCAGCTAGGTGCCTCCAAGAAACCCCGCCCCAGAGGACCCGCACGAGTTG
CTGCCATTTTTCGCTGAAGCCCCTGCCCTGGGGCTGGTGTTCTTCTCTATGATTCTACCA
ATCGTCGGCATTTTTTTCCTCCCTTCTTTCTTTTTAGGAAGGCGCTGGGGTGTGCGGCGG
CAACGGCGGCGGTGAAGGGATCCTCTTGTGGTATCTCCTCGTGGGTTCCTGTCTTGAAGG
ATTTCTTCTCCGCCTCAACTTTATGTTCAAGTAGCGCTTTGGGGGTTGGGTTGGTTTTCA
TAGCCCCCACCCCCGGCCCTCTCCTTTTAAAGGGTGTGTGGAGTTCAGAGGATGGGTGGA
GAGCGGGCTTGGCCGGAACTGAATTGGTAGAGGTAAAAGGGGAACGGAGGACCTTAAGCT
CTGGCCACTTCGGCCCAGCGAACCCACTTTATTTTTGTCCAAGGAAAAGCTGCAGGGGGG
AGGATTCTTTTTAGGAAGTCTACTCTGCCGGCCCCTGATTTTTGGGTTGGATGCTTGAGA
GCTTTGTTTCCCTTGTTCCGAGAGTGGCCCAGCTGGGTCTGAATCGACTCCCTCCCCTTT
CGACCCCCTCCTCATTTTCCAGCCCGGAGAAATAGGGGAGTGGGGGCCCAAGAACGAGAA
GACGAGAACGCGTCGCCCTGCGCTATGTCAGAATGGGGCGGGTGTGAGGGGAACAGCTCT
CTTGCGATCAGCTCAGGAGTATGAGCCTCCCGGAGGACGGCATGAGTTCTGGACACTTCA
GGAGTCCTCAGCTAGTGACATGGTCGATATGGATAAACTCATAAACAACTTGGAGGTCCA
ACTTAATTCAGAAGGTGGCTCAATGCAGGTATTCAAGCAGGTCACTGCTTCTGTTCGGAA
CAGAGATCCCCCTGAGATAGAATACAGAAGTAATATGACTTCTCCAACACTCCTGGATGC
CAACCCCATGGAGAACCCAGCACTGTTTAATGACATCAAGATTGAGCCCCCAGAAGAACT
TTTGGCTAGTGATTTCAGCCTGCCCCAAGTGGAACCAGTTGACCTCTCCTTTCACAAGCC
CAAGGCTCCTCTCCAGCCTGCTAGCATGCTACAAGCTCCAATACGTCCCCCCAAGCCACA
GTCTTCTCCCCAGACCCTTGTGGTGTCCACGTCAACATCTGACATGAGCACTTCAGCAAA
CATTCCTACTGTTCTGACCCCAGGCTCTGTCCTGACCTCCTCTCAGAGCACTGGTAGCCA
GCAGATCTTACATGTCATTCACACTATCCCCTCAGTCAGTCTGCCAAATAAGATGGGTGG
CCTGAAGACCATCCCAGTGGTAGTGCAGTCTCTGCCCATGGTGTATACTACTTTGCCTGC
AGATGGGGGCCCTGCAGCCATTACAGTCCCACTCATTGGAGGAGATGGTAAAAATGCTGG
ATCAGTGAAAGTTGACCCCACCTCCATGTCTCCACTGGAAATTCCAAGTGACAGTGAGGA
GAGTACAATTGAGAGTGGATCCTCAGCCTTGCAGAGTCTGCAGGGACTACAGCAAGAGAG
AGAAGCCTTATAAATGCACCTGGGATGGCTGCTCCTGGAAATTTGCTCGCTCAGATGAGC
TCACTCGCCATTTCCGCAAGCACACAGGCATCAAGCCTTTTCGGTGCACAGACTGCAACC
GCAGCTTTTCTCGTTCTGACCACCTGTCCCTGCATCGCCGTCGCCATGACACCATGTGAG
CCGCACAGGTCACACTAGAGAAGCTGCGCTGGTATCTTTCCTGGTCGTGTGCTGAGGTTG
GGACAATTTTTTCCTCTTTGACTTCAGCTTGCATATGGGGTTGAAGCAGCCCACTGAGCC
AAGTTGAGGAGACTGGAGGAAAAGAGAGCTGGTCTCCCGTGGGGCTCTTCATATTCTACC
TTCACTTCTCCACTGTCCAGACCCGTTTTTTTCAACCTCCACATGGGTTGAATTCCAGTG
TGGCACCCATGGCTGCCTTCCCATCCCCCCCTGCTCTGAAATAGGACATTTTTCCTACAG
TAACAAAACAGGAATCAAACTCAAGGCTGTGAACAAACATACGCTGCTTTATTCTTTCCA
ATTTTTCTCTTGTTTTCTAGAACTCTTATCCATATGTTTTTAAAATAAGTACCTAAAAGT
GGTTTGATAGTGTCCTAAACGACTTTTTTAACTTCCTAAATGGAAAGAGCATAACAATGT
AGTTGATTGGTAAGATTTACAGGGATTTGGTTTCTGAGTTTGAGGCACATTCCCAGTGAA
TAAGCTGAGTCCCATACCACACTCAAAAGGTTTTAATAAATCTAATCCTATTTCTTCTTA
AAGTTTGGTTTTCAGACAGTGCTGGTGCTTCTGCTTCTTAAGTTCATCAAGGGAATGAGG
AGTTCTTGTCCTTCTCCTCCTCTTTTTTTTCTTTTCCACTTTCTCCTTCAGGATTAAAGA
TTTTGCTGCACAATTGTTATTTGTTAGGTTAAATTTGGACAAATATTCAAAGCACACATA
GACATATAAGTAAGGAGAAAAATGTTCCAGGAGAGTAGGTTGGGCAGTGACAGGAACAAA
CAGACCTAGGATGATCCTGAGAACAAATAGAGGGGTTCCTTTACTTGTATAGGATATCAA
AAGTGCTGTTAATCACAAACCTCATTCAAATGGCAGGCTGTCGAGACAGTGTCTTGAGGG
GCTGGCTGTACTGTTTATTTTTTCGTTTACACAAAGAAGCAATTGAGTATATTGCATGAT
GAGAAATCACACACTAGGGTCATGTTATACAGAAGTAAGGGGTTGGAAAAATGGAATGTT
GTTCACTCCATGGAATTATTGGCATTCATTCCTGTGTTTCAAATGAAACATAGATGCTTT
TCATGAAAACTGACCTACAAAAAGCAATTTGATGTTCTGCAACTGCTATGAAAACCTAAG
CCATTTATTTTAGCTGATAGCAGATTGCATAATATACTCATTTAGCTGCCCAATCAGATT
GTTTTATAATATTACCTGGGGTACAAAATCCTCTGTTCCTGGCCCTGGACCACAGATCTA
CCTCCACATGGCATATTTCCTTTCTGGGGTCAGGGGTAGGGGAGGGGGCTTTGCATCACT
TGAATTTAGACTCAGCCTCTCTTTAAAAGATTGTCTTTATATTGAACACCTTTTTCTTTT
CAACCCTGCTTGAATACTTTAGGTTACTATTTCCTGAGGCTGTCCATTCTCACTATATTG
TAGAATTCTAGCACCAAGAAGGGATCCCGTTAACCATCTAGTCCTATCCATCCCTCATAT
TTTACAGATGAGACAAATACGGGTCAGATTTTTTTCTCCAGATGTTTCTTTGAGCCCTTA
TACACCTGCACGCTTATTCTCCTGGGGATCACATAATTTTATTTATTTATTTTTTGAGAG
ACGGTTTCACTCCATCACCCAGGCTGGAGTGCAGTGGCGTAATCTTGGCTCACTGCAACC
TCCGCCTCCTGGGTTCAAGTGATTCTCCTGCCTCAGCCTCCCAAATAGCTTGGATTACAG
GTGCGTGCCACCACACCTAGCTAAGTTTTGTATTATTAGTAGAGATGGGGTTTCGCCATG
TTGGCCAGGCTGGTCTCAAACTCCTGACCTCAAGTGATCCCCCCACCTCGGCCTCCCAAA
GTGCTGGGATCACAGGTGTGAGTCACCACACCTGGCCAGGATCACATTATTAAACCAAAT
TAAAGTTTATGTGATTGGTTGCAATATTTGTCTAATTTTATATGTTTTCTTCAGGAAAAC
TTTAGAACTCAAAAATCATTTACAGCTGATTAAATAGCAAGTAAAATGTACTTGTGGTCA
TTGCCGTATAACATTAGGCACACGCTTCTAACACTTCTATAATATCTAGATTTTATTTAC
CTCATTTTAACTTGCAATGTCTGTCTATCTCATGAACTCTCCATAAATCCAAGAACTGCC
TGTAGTTTTCAAAATGACATGTGGGTTTTTACTGTTATCATTGTTATTTCGATAGGGCTT
TTTCCTGATTTTGGGTATACAAGTTCCAAACTTGCATAATAATTGCTAACGCACTAGGCG
ATATCTAGGGCCAGTCTGTTAAAGGGGACCTCTAATGTAGCTATAAGACAGGTTGGTAAA
GATGAACTAACATAAGTTTAAGCTAATAATTCAGTAGTTGATGCAGTATTTCACAGTAGA
GCCCGAGCTTACTCATTTTTTTCAAAATTTGGATCCTGATACTCCTTTTTCAGAGTTCAG
AACTGAACTGCTCCCCTAAGACCTCAGAATCTTTTGCATTGAGACATATGATCTATTTAT
AAATAAAGGTTATCAAATATCTTGTTGAACTAATTAGGTTGATCAAATTAGGATCCCAAA
TATTGGGGTCCCTGACATCTGAGCCTTTATCTAAAAATGTTTCTGTAACATAATGACAGC
CTTTATGTTTGTTAATTGCCTATAGTAAAGAAGCAATTTTAAGCCTATTCTCATTTCCCT
CTCCCCTACAAAAAATGATAAAAGCTTTCCAATTACTTACATATGCTCTAACAAGTGTCT
CAGGATTCATTAACAGAATTTTATAGAGTACAGTAATTCAAATATAGCACAGTACAGAGT
TTACCAAAAACACATAAAACTTTGCTAGATAGACAGTGAGGTGGAAAGGAACTAAAATGT
ATCTCTCTTGAATAGCATTTGGGGTTCAATTGAATTTGTTGTGTTTACAACAGCAAAGCA
CCGTTAGCCTGGACAGTTGCTTATGGCATCGATAGGGTTGGATAATATTCTGGGATTTGT
TGCAGCAGAATTCCTCTATCTGATGATCAGCAGTTGAACATAAACTTCATAATTATAGTA
AAATTTAGGAAAAACTATGAGTGTGAAGAGTATGAACTGATTGGGTAGATTAGGCAGAGT
GCATTATGGGCAAGACAAAGGTTTTCGATATTAACTTCTTTTAAAATAAACTTTTTATTT
TCAAACAGTTTCAGTTTTACAGAAAAAATGTGAAGCTAGTACAGAGAGGTCTCATTTACC
CCACACCCAGTTTCTCCTGTTATTAGCATCTCACATTAATATGTGGTATATTTGTTACAA
TTAATAAAACACATTGATATGTTAATATTATTAACTGAAGTCCATACTTTATTCAGGTTT
CTTTAGTTTTTACCTAAGATCCTTTTTAAAGAATTGTTTCGGCCAGGCACTGTGGCTCAC
ACCTGTAATCCCAGCACTTTGGGAGGCCAAGACGGGCGGATCACGAAGTCAGGAGTTCGA
GACCAACCTGGACAACATGGTGAAACCACGTCTCTATTAAAAATACAAAAAATTAGCCAG
GCGTAGTGGTGGGTGCCTGTAATCCCAGCAATACTTGAGAGGCTGAGGCAAGAGAATTGC
TTGAACCTGGGAGGCGGAGGTTGCAGTGAGCTGAGATCATGCCACTTCACTCCAGCCTGG
GTGACAGAGCGACACACTTGATCTCAAAAAAAAAAAAATTGTTTCAGCATCTTGTTCAGG
ATTCCACATTACATCTAATAGTCATATCTCCTTAGGATCCTTTTGATTGTGACAGTTTCT
CAGACTTTCCTTGTTTTCAGTGACCTTGACACTTTTGAGAGAGATTTTCCTCAACTGGGA
TTTGTCAGTTGTCTTTCTCATGATTAGACTGAGGTTATGAGTTTTTGAAAGTAGGACCAC
GGAGAAGAAGTGCCATTTTCATCACATCATACAGGCATACTTTGGAGACAATGCAGATTT
GGTTCCAGATCACTGCAATGAAGCAAATATTACAATAAAGCAAGTCACACAAATTTTTTG
GTTTCCCAGTGCATATAAAATTTTATGTTTACACTATCCTGTAGTCTGGTAAATGTGCAA
TAGCATTATGTCTAAAAAACAATGTACATACCTTATTTTAAAATACTTTATTGCTAACAT
GTTACTGGCACAAACACGAAGTGAGCACATGCTGTTGGAAAAATGGTGCCAATAGACTTG
TTGGTCACAGGGTTGCCACAAACTTTTAATTTGTAAAAAATGCAATATCAGCAAAGTGCA
ATAAAGTGAAGCACAATAAAACGAGGTATGCCTGTATTTACATGACTCATCACTGTTGTT
TAACCTTGATCACCTGGCTGAAATAGTTGTTGTCAGGTTTCTCCCCTGTACTCTTTTTTT
CCTCCCCTCCATACTGTACTCTCTGAAAGGAAATCACTATGTGCAGCCCATGCTTCTGGA
GTGGTAAGTTATATGCCACACCCTTCAGAGCATGTATCTTACATAAATTATTTGGAATTA
TTCTCTAAGGGAGATTGTCTCTTCTCCCCCATTTATTTATTTATACAATACTTTATTTAT
ATCAGCATGGACTCATGGGTATTTATTTTATACTTCGAGTTATAATCTAATACTACTACT
TTATTTTATTGCTCGAATTGTTCCAGCTTTGGCCATTGGGAGCTCTTTTGGGTGATTCTC
AAGTTCTTTTGACACACCCCCATCATTTTTTTTTAGCACGTCCTTACTTTCTGCCACTGC
AAGATCTTCCAGGCTCATCTTGTATATTTTGTGGCCTACTCCTATAATCAGCCATTTCTT
CAAGAAGTCCTGGTTTCTTTTACTGGAAAATTGTATTAGAAACCAATATCTGGGCATTAG
GTATGTTCATTGTTACTGGGCTATTGTTGCTTCTAGGGTGTCTCAGCTAACAGCAAGGAA
ACATATGTGTGTATACTATCCTATGTATATGCACATTCTATAAATATTTCTATATGTAAT
CACCCAGATTTTTATTTAGCTAAACATGAGTTCATATTGATGTTTTCAACTCTAACCTGT
TACCACGTGAATCATTCTAGCTTCTTCCTGTTAGTTACATGAAGCCTCCCACACTAATAC
TGAGAAACCTGGCTCTCAACCTCTGTCATCTATTTACTTAATTTTTCAAATTCAGTGTGC
ACATATAGCAGTATCTGAATTGTTAACCTGTATACCCATGGGAAACAACTTTATCAACTA
CAGCACAGTGTGTATGTACATAAAAATAGTAATATTTTTAGAACTCCAACAGCTCTTTGA
AACAAAGTGGTCTGCAAAATTCTGGAATTAGGGATTTCTGTGATCTGAGTTCCAAGATTC
TGGGGTCTATCCTGCCCCCAAAAAGTTTTCTCATGAACCAAACCATCAAGAATGTACCTA
ACCTTAAATAAGCCAAGGGAACTTACTGATGCTCCACAGTTTGCTAATTCTTGTATGAGG
TACTGTAGAGGGATGGATACAGAAGGAACTGGGTGGGCCAAATTTAAATAAACACATAGC
ACTATCTTTTCTCACTGTTAAATATGGCTCTCTGACAACAGTGATGCTACCCTGAGTTAC
CTCTCTTCTGTATTTTCCCAGATCTCACTTGGTTGACCTTAGGCAAGTCATATCACCTCT
CTGTGCCTCAATTAATCCATTTGCAAAATGGGGATCTCAATATCTACCTCACAGGAATGT
TGTGAGGCTTCTCATAAATTGATTTTGGCAAAAATGAAAGATCTTTAAGTGAACAACCAA
GTATTATAACCATTGTTATAATGATAGTTATAGTACCTTATATTTACCCTATGTAAAAGA
GAAGATTAGGCTTCCTAGGTGATAAACAGATAAATTTGAGTAAGAAGGATAATTAAAGAG
TGGCCACTGGAAGCAATATTATTTATTCTCTTACTTTCACTTTCCCTATATCTTCTTTGT
TACTAACAATACGATTATCATCTGTTTCCATACTTGAAATGTATTAGGACCTAAAGGAAG
AGGTAGGCAAAATTCATTGCTTCAGAAGCTGTATTCTTCCCCCTTTGTAACTCTGCTTGG
ACCACATTCCATGTCACATTCTCAGAAGCACAAAGGCAATTTTCCAGAGCCCTTTAAGCT
TTGGCCAGTTCAGTTTCACCACTTATATTTTCTCTTTCCCAACTTACTTTACTCTGAATA
GTATAGGTAGGAGGAGGGAAGTTGGGTAGGGTGGTTGGGGGTGGGAGTGGGTTGGAAGAG
GATGGGATTTATACCAGTGGCAGGATATTTCTCTGTTTTCCAAACACTGGTTTTAATTTC
CATTTCCTTTTCTGGTGTTGGGGTGGGGTCAGGGGAAGAGATACTATTTTGTTAACTGTT
AAAAGCTCTCCTTCCTTTCCTAGAGTCGCTACAAGTAGCTGTGTTGGACATTACTTTATA
ACTATGCTGTATGCCATGCTGTTTTCATTGTATCACAGAATTAAAAGGGGAAGAGAGTTC
CTAGTGGTGTCCATCCCTGTTTTTTGACAGGCAGTCACACAGGTGAGCAGTGCCAGAAAC
TGGTTCTCTTTTTTGTGTTGGGGAAAGGAGCCTGCAGTGAAAGGATCAGTTGGATTTTTT
GTCATTGTTAGTTTGTTTAAATAAATTATAAGACAGTATATTAAGCTTTAGTCTCTGTAA
CTCTTATGTTTGTGCCCCATTATTTTAGTGCTTTAGAGCAACACCTTGTTTTTCCTCTAT
TTTATACTAGTTCTTGCTCCAGAGGCATGGCTTTGAGGCTAGAATCATGAGCAATCTCTC
ATAAACAAGTCTGTTATGCACCTGGAGATACTCAAGATTTGCCTCTGTTAGCATGGCCAC
TTAGAGATTACTCTGTTCTACTTCAGAGACCCTCCACTATGGCATCCATGCAGGGTGTGT
GCTTGGGGACTAAGCAATCTTGTTCAGTTTAATTATTGTACTTTTTTATTAATAAAAAGG
TCTTAAACTTCA

Protein Sequence

>11279 : length: 359
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENP
ALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTL
VVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPV
VVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESG
SSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKVYTKSSHLKAHRRIHTG
EKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLSLHRRRHDTM