ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11266

Name

DUSP12

Synonym

DUSP1|YVH1;dual specificity phosphatase 12;DUSP12;dual specificity phosphatase 12

Definition

YVH1 protein-tyrosine phosphatase ortholog|dual specificity protein phosphatase 12|dual specificity tyrosine phosphatase YVH1|serine/threonine specific protein phosphatase

Position

1q21-q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Oxidative stress response;PANTHER;P00046

Disease

diabetes, type 2;GAD

Disease

Diabetes mellitus;FunDO

Disease

METABOLIC;GAD

External Links

Links to cell senescence gene database

11266

Links to epithelial mesenchymal transition gene database

11266

Links to ovarian cancer gene database

11266

Links to endometrial cancer gene database

11266

Links to iHOP

11266

Sequence Information

Nucleotide Sequence

>11266 : length: 1285
AGGGCAGGAAGCCGCCTTGTCTCTGGGCGCGGCCATGTTGGAGGCTCCGGGCCCGAGTGA
TGGCTGCGAGCTCAGCAACCCCAGCGCCAGCAGAGTCAGCTGTGCCGGGCAGATGCTGGA
AGTGCAGCCAGGATTGTATTTCGGTGGGGCCGCGGCCGTCGCGGAGCCAGATCACCTGAG
GGAAGCGGGCATCACGGCCGTGCTAACAGTGGACTCGGAGGAGCCCAGCTTCAAGGCGGG
GCCTGGGGTCGAGGATCTATGGCGCCTCTTCGTGCCAGCGCTGGACAAACCCGAGACGGA
CCTACTCAGCCATCTGGACCGGTGCGTGGCCTTCATCGGTCAGGCCCGCGCTGAGGGCCG
TGCGGTGTTGGTGCACTGGTCTCTTTTTCAGTCATGCAGGAGTCAGTCGAAGTGTGGCCA
TAATAACTGCTTTTCTCATGAAGACTGACCAACTTCCCTTTGAAAAAGCCTATGAAAAGC
TCCAGATTCTCAAACCAGAGGCTAAGATGAATGAGGGGTTTGAGTGGCAACTGAAATTAT
ACCAGGCAATGGGATACGAAGTGGATACCTCTAGTGCAATTTATAAGCAATATCGTTTAC
AAAAGGTTACAGAGAAGTATCCAGAATTGCAGAATTTACCTCAAGAACTCTTTGCTGTTG
ACCCAACTACCGTTTCACAAGGATTGAAAGATGAGGTTCTCTACAAGTGTAGAAAGTGCA
GGCGATCATTATTTCGAAGTTCTAGTATTCTGGATCACCGTGAAGGAAGTGGACCTATAG
CCTTTGCCCACAAGAGAATGACACCATCTTCCATGCTTACCACAGGGAGGCAAGCTCAAT
GTACATCTTATTTCATTGAACCTGTACAGTGGATGGAATCTGCTTTGTTGGGAGTGATGG
ATGGACAGCTTCTTTGCCCAAAATGCAGTGCCAAGTTGGGTTCCTTCAACTGGTATGGTG
AACAGTGCTCTTGTGGTAGGTGGATAACACCTGCTTTTCAAATACATAAGAATAGAGTGG
ATGAAATGAAAATATTGCCTGTTTTGGGATCACAAACAGGAAAAATATGAACATGATATT
TTATAGCTTGGGAAGAAACTTGCAGATGATATGTGCTGCCTTTGCTTCTTATCATTCATG
GCAGATTGTTTGTGCTTTCAACATTTCATTTGAAATGGGAGAAGATAAAATCACTTGATG
TAACCTGGAAACTATGCTTTACATGGCAATCAAAGCCTTTTGATCATGTACATTTTATTT
GATATTAAAATCTTTTATAACCAGA

Protein Sequence

>11266 : length: 340
MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLREAGITAVLTVD
SEEPSFKAGPGVEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVS
RSVAIITAFLMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYK
QYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREG
SGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSF
NWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTGKI