ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11240

Name

PADI2

Synonym

PAD-H19|PAD2|PDI2;peptidyl arginine deiminase, type II;PADI2;peptidyl arginine deiminase, type II

Definition

protein-arginine deiminase type II|protein-arginine deiminase type-2

Position

1p36.13

Gene Type

protein-coding

Pathways and Diseases

Pathway

protein citrullination;BioCyc;PWY-4921

Disease

Arthritis;FunDO

Disease

Spondylarthropathies;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Multiple sclerosis;FunDO

External Links

Links to cell senescence gene database

11240

Links to epithelial mesenchymal transition gene database

11240

Links to ovarian cancer gene database

11240

Links to endometrial cancer gene database

11240

Links to iHOP

11240

Sequence Information

Nucleotide Sequence

>11240 : length: 4363
GCAGGCTGCTGGAGAAGGCGCACCTGCTGCAGGTGCTCCCGGCCGCCCCGGACCAGCGAG
CGCGGGCACTGCGGCGGGGAGGATGCTGCGCGAGCGGACCGTGCGGCTGCAGTACGGGAG
CCGCGTGGAGGCGGTGTACGTGCTGGGCACCTACCTCTGGACCGATGTCTACAGCGCGGC
CCCAGCCGGGGCCCAAACCTTCAGCCTGAAGCACTCGGAACACGTGTGGGTGGAGGTGGT
GCGTGATGGGGAGGCTGAGGAGGTGGCCACCAATGGCAAGCAGCGCTGGCTTCTCTCGCC
CAGCACCACCCTGCGGGTCACCATGAGCCAGGCGAGCACCGAGGCCAGCAGTGACAAGGT
CACCGTCAACTACTATGACGAGGAAGGGAGCATTCCCATCGACCAGGCGGGGCTCTTCCT
CACAGCCATTGAGATCTCCCTGGATGTGGACGCAGACCGGGATGGTGTGGTGGAGAAGAA
CAACCCAAAGAAGGCATCCTGGACCTGGGGCCCCGAGGGCCAGGGGGCCATCCTGCTGGT
GAACTGTGACCGAGAGACACCCTGGTTGCCCAAGGAGGACTGCCGTGATGAGAAGGTCTA
CAGCAAGGAAGATCTCAAGGACATGTCCCAGATGATCCTGCGGACCAAAGGCCCCGACCG
CCTCCCCGCCGGATACGAGATAGTTCTGTACATTTCCATGTCAGACTCAGACAAAGTGGG
CGTGTTCTACGTGGAGAACCCGTTCTTCGGCCAACGCTATATCCACATCCTGGGCCGGCG
GAAGCTCTACCATGTGGTCAAGTACACGGGTGGCTCCGCGGAGCTGCTGTTCTTCGTGGA
AGGCCTCTGTTTCCCCGACGAGGGCTTCTCAGGCCTGGTCTCCATCCATGTCAGCCTGCT
GGAGTACATGGCCCAGGACATTCCCCTGACTCCCATCTTCACGGACACCGTGATATTCCG
GATTGCTCCGTGGATCATGACCCCCAACATCCTGCCTCCCGTGTCGGTGTTTGTGTGCTG
CATGAAGGATAATTACCTGTTCCTGAAAGAGGTGAAGAACCTTGTGGAGAAAACCAACTG
TGAGCTGAAGGTCTGCTTCCAGTACCTAAACCGAGGCGATCGCTGGATCCAGGATGAAAT
TGAGTTTGGCTACATCGAGGCCCCCCATAAAGGCTTCCCCGTGGTGCTGGACTCTCCCCG
AGATGGAAACCTAAAGGACTTCCCTGTGAAGGAGCTCCTGGGCCCAGATTTTGGCTACGT
GACCCGGGAGCCCCTCTTTGAGTCTGTCACCAGCCTTGACTCATTTGGAAACCTGGAGGT
CAGTCCCCCAGTGACCGTGAACGGCAAGACATACCCGCTTGGCCGCATCCTCATCGGGAG
CAGCTTTCCTCTGTCTGGTGGTCGGAGGATGACCAAGGTGGTGCGTGACTTCCTGAAGGC
CCAGCAGGTGCAGGCGCCCGTGGAGCTCTACTCAGACTGGCTGACTGTGGGCCACGTGGA
TGAGTTCATGTCCTTTGTCCCCATCCCCGGCACAAAGAAATTCCTGCTACTCATGGCCAG
CACCTCGGCCTGCTACAAGCTCTTCCGAGAGAAGCAGAAGGACGGCCATGGAGAGGCCAT
CATGTTCAAAGGCTTGGGTGGGATGAGCAGCAAGCGAATCACCATCAACAAGATTCTGTC
CAACGAGAGCCTTGTGCAGGAGAACCTGTACTTCCAGCGCTGCCTAGACTGGAACCGTGA
CATCCTCAAGAAGGAGCTGGGACTGACAGAGCAGGACATCATTGACCTGCCCGCTCTGTT
CAAGATGGACGAGGACCACCGTGCCAGAGCCTTCTTCCCAAACATGGTGAACATGATCGT
GCTGGACAAGGACCTGGGCATCCCCAAGCCATTCGGGCCACAGGTTGAGGAGGAATGCTG
CCTGGAGATGCACGTGCGTGGCCTCCTGGAGCCCCTGGGCCTCGAATGCACCTTCATCGA
CGACATTTCTGCCTACCACAAATTTCTGGGGGAAGTCCACTGTGGCACCAACGTCCGCAG
GAAGCCCTTCACCTTCAAGTGGTGGCACATGGTGCCCTGACCTGCCAGGGGCCCTGGCGT
TTGCCTCCTTCGCTTAGTTCTCCAGACCCTCCCTCACACGCCCAGAGCCTTCTGCTGACA
TGGACTGGACAGCCCCGCTGGGAGACCTTTGGGACGTGGGGTGGAATTTGGGGTATCTGT
GCCTTGCCCTCCCTGAGAGGGGCCTCAGTGTCCTCTGAAGCCATCCCCAGTGAGCCTCGA
CTCTGTCCCTGCTGAAAATAGCTGGGCCAGTGTCTCTGTAGCCCTGACATAAGGAACAGA
ACACAACAAAACACAGCAAACCATGTGCCCAAACTGCTCCCCAAAGAATTTTGAGTCTCT
AATCTGACACTGAATGAGGGGAGAAGGGAAGGAGATTCTGGGATTGCCAGTTCTTCCAGC
AGCCATGCTCTGAAAATCAAGGTAGAATCCATGGAAAGGGACCCCAGGACCCCGGGACCC
TAGACGTATCTTGAACTGCCATCGTCATTTCAAATACATCTCCCTCAGGGTTTCCAGGTG
GCCACCCCCAATTATTCATTCCTTACCAACCTCTCAAATCCTCTTGGCTTTCTCTCTGCA
GTGTGGACACTGTTGGCTAGTCCTCCCCACTCCCTGAGGGTCCAGTAAGTTAGCTTAGAA
CCTTCCTGGAAACATTTCATCTGAGCAGGTTTCCCCACGTGTGGGATGCTCCTTTTGCCT
CATCTGTCTCAGGGATGCAGGCTCCCCCGCATGCATGGGGATTTCTCCCCAGACCAGCAT
ACTTGTGACCTGAGAGTTCAATGCGTAAAGATGCCCCTGGTCAGCCATATCCATCTTCTC
TTGCCTGGTCCTTGATTCTCTGGCCGCTCCCTGACCTTCCTCCTTCCACTGCCTTGACTT
TCTTCCTTTTTATTCCTGGTGCCATCTGTCCAGGCAGCTAGACAAGAACTTGTTCGCCAG
CAGCCAGATTCAGGCCTTCCCAGGGGCATAATAAGTGACCAGCCCCTCCTCTCCGGACAT
CAGATCCAACACATAAGGACCCTGGCCTACCCTCCAGCCCAACAGCCAGTTCTGGGTCAG
CTGCCAACTTAGGGGTGGTTTGATTATCCCATTGAAATTCACCAGTGCCTTTGCCAAAGA
CCCTCTCATTTGGACATACCCAGATTCATTCCCTGGCTCCAACTGAAAAGACTCAGTTTC
AATCGTTAAAAGTTCCTTTAGGGCCAGAAGAATAAATGAATTATAATCCCATTTTGAAGA
ACCGATTTATAACCAATGAAAAGGTTATAATGTAATTTATATTCTTGGAGGAACAAGATT
TTCATTTGGGATTATTTCCTTCAACCATTCAACAAACATTTGTTGTATGCCACTAAGCGC
CAGGCACGGCGTTGGGCTCTGCAAACACAGTGGTTAGTAGCAGTCTGGACCTGGTCCCTA
CTGGCATGGAACCCATCACTCCCCAACATGCAAAGCCCACATTTAAAGGCCAGCCTCTGC
CCCTTCAGTGATGCGCTCTTTAGAAATGCCAGTCCACTATATTCAGAAATCCGCAGGGCA
CAAAACTTCCAGCAAGTCACTGTTGTGGTGAAATGGGCAGTGGGGGTGGGGGGTCTTCTT
TAAACAGGCCCCCTTCCCATCTACCTAGCCAGTACCCATCCAATGAGTCCCCAGAGCCTC
CAGAAGCTGTTGTCTCCTCTCTGGGGACAGCAGCTCCTGCCTTTGGAGGCCAAAGCCCCA
GATCTCTCCAGCCCCAGAGCTGAAAACACCAAGTGCCTATTTGAGGGTGTCTGTCTGGAG
ACTTAGAGTTTGTCATGTGTGTGTGTGTGTTTGGTTAATGTGGGTTTATGGGTTTTCTTT
CTTTTTTTTCTTTTTTTTTTTAGTCTACATTAGGGGGAAGTGAGCGCCTCCCATGTGCAG
ACAGTGTGTCTTTATAGATTTTTCTAAGGCTTTCCCCAATGATGTCGGTAATTTCTGATG
TTTCTGAAGTTCCCAGGACTCACACACCCGTTCCCATCTCACTTGCCCACCCAGTGTGAC
AACCCTCGGTGTGGATATACCCCCGTGGACTCATGGCTCTTCCCCACCCCCACTTTCTAT
AAATGTAGGCCTAGAATACGCTTCTCTGTTGCAAAACTCAGCTAAGTTCCTGCTTCCACC
TTGATGTTGAAATATCTTATGTAAGAGGGCAGGGGATGTCGTGAAGATGGCAAGAAGAAC
ACAGTTTCAAATTTCTGGAAAAGAGCCTGTGGTGGAGATCTAAAGATGTTTAGGGAAGAG
CTCGACTAAAGAACAATGAAATAAATGGTCCAAGGGGAAGTCA

Protein Sequence

>11240 : length: 665
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEE
VATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKD
MSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVP
IPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQE
NLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKW
WHMVP