ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11214

Name

AKAP13

Synonym

AKAP-13|AKAP-Lbc|ARHGEF13|BRX|HA-3|Ht31|LBC|PRKA13|PROTO-LB|PROTO-LBC|c-lbc|p47;A kinase (PRKA) anchor protein 13;AKAP13;A kinase (PRKA) anchor protein 13

Definition

A-kinase anchor protein 13|A-kinase anchoring protein|LBC oncogene|breast cancer nuclear receptor-binding auxiliary protein|guanine nucleotide exchange factor Lbc|human thyroid-anchoring protein 31|lymphoid blast crisis oncogene|non-oncogenic Rho GTPase-s

Position

15q24-q25

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

rho-selective guanine exchange factor akap13 mediates stress fiber formation;PID BioCarta;100248

Pathway

Regulation of RhoA activity;PID Curated;200050

Disease

Herpes;FunDO

Disease

smoking cessation;GAD

Disease

CHEMDEPENDENCY;GAD

Disease

breast cancer;GAD

Disease

Leukemia;FunDO

Disease

CANCER;GAD

Disease

Eating disorder;FunDO

Disease

Endometriosis;FunDO

Disease

Breast cancer;FunDO

External Links

Links to cell senescence gene database

11214

Links to epithelial mesenchymal transition gene database

11214

Links to ovarian cancer gene database

11214

Links to endometrial cancer gene database

11214

Links to iHOP

11214

Sequence Information

Nucleotide Sequence

>11214 : length: 13347
GCGCGGAGCCCGAGCAGCCGCGGTGAAGCGCCTGTGCTCTGCCGAGACTGCCGTGCCCAT
TGCTCGCCTCGGTCGCCGCCGCTTTAGCCGCCTCCGGGGGAGCGGCCGCCTATTGTCTTT
CTCCGCGGCGAAGGTGAAGAGTTGTCCCAGCTCGGCCCGCGGGGGAGCCCCGGGAGCCGC
ACGTGTCCTGGGTCATGAAACTTAATCCACAGCAAGCTCCCTTATATGGTGATTGTGTTG
TTACAGTGCTGCTTGCTGAAGAGGACAAAGCTGAAGATGATGTAGTGTTTTACTTGGTAT
TTTTGGGTTCCACCCTCCGTCACTGTACAAGTACTCGGAAGGTCAGTTCTGATACATTGG
AGACCATTGCTCCTGGTCATGATTGTTGTGAAACAGTGAAGGTGCAGCTCTGTGCTTCCA
AAGAGGGCCTTCCCGTGTTTGTGGTGGCTGAAGAAGACTTTCATTTCGTCCAGGATGAAG
CGTATGATGCAGCTCAATTCCTAGCAACCAGTGCTGGAAATCAGCAGGCTTTGAACTTTA
CCCGTTTTCTTGACCAGTCAGGACCCCCATCTGGGGATGTGAATTCCCTTGATAAGAAGT
TGGTGCTGGCATTCAGGCACCTGAAGCTGCCCACGGAGTGGAATGTATTGGGGACAGATC
AGAGTTTGCATGATGCTGGCCCGCGAGAGACATTGATGCATTTTGCTGTGCGGCTGGGAC
TGCTGAGGTTGACGTGGTTCCTGTTGCAGAAGCCAGGTGGCCGCGGAGCTCTCAGTATCC
ACAACCAGGAAGGGGCGACGCCTGTGAGCTTGGCCTTGGAGCGAGGCTATCACAAGCTGC
ACCAGCTTCTAACCGAGGAGAATGCTGGAGAACCAGACTCCTGGAGCAGTTTATCCTATG
AAATACCGTATGGAGACTGTTCTGTGAGGCATCATCGAGAGTTGGACATCTATACATTAA
CCTCTGAGTCTGATTCACATCATGAACACCCATTTCCTGGAGACGGTTGCACTGGACCAA
TTTTTAAACTTATGAACATCCAACAGCAACTAATGAAAACAAACCTCAAGCAGATGGACA
GTCTTATGCCCTTAATGATGACAGCACAGGATCCTTCCAGTGCCCCAGAGACAGATGGCC
AGTTTCTTCCCTGTGCACCGGAGCCCACGGACCCTCAGCGACTTTCTTCTTCTGAAGAGA
CTGAGAGCACTCAGTGCTGCCCAGGGAGCCCTGTTGCACAGACTGAAAGTCCCTGTGATT
TGTCAAGCATAGTTGAGGAGGAGAATACAGACCGTTCCTGTAGGAAGAAAAATAAAGGCG
TGGAAAGAAAAGGGGAAGAGGTGGAGCCAGCACCTATTGTGGACTCTGGAACTGTATCTG
ATCAAGACAGCTGCCTTCAGAGCTTGCCTGATTGTGGAGTAAAGGGCACGGAAGGCCTTT
CGTCCTGTGGAAACAGAAATGAAGAAACTGGAACAAAATCTTCTGGAATGCCCACAGACC
AGGAGTCCCTGAGCAGTGGAGATGCTGTGCTTCAGAGAGACTTGGTCATGGAGCCAGGCA
CAGCCCAGTATTCCTCTGGAGGTGAACTGGGAGGCATTTCAACAACAAATGTCAGTACCC
CAGACACTGCAGGGGAAATGGAACATGGGCTCATGAACCCAGATGCCACTGTTTGGAAGA
ATGTGCTTCAGGGAGGGGAAAGTACAAAGGAAAGATTTGAGAACTCTAATATTGGCACAG
CTGGAGCCTCTGACGTGCACGTCACAAGTAAGCCTGTGGATAAAATCAGTGTTCCAAACT
GTGCCCCTGCTGCCAGTTCCCTGGATGGTAACAAACCTGCTGAGTCTTCACTTGCATTTA
GTAATGAAGAAACCTCCACTGAAAAAACAGCAGAAACGGAAACTTCACGAAGTCGTGAGG
AGAGTGCTGATGCTCCAGTAGATCAGAATTCTGTGGTGATTCCAGCTGCTGCAAAAGACA
AGATTTCAGATGGATTAGAACCTTATACTCTCTTAGCAGCAGGCATAGGTGAGGCAATGT
CACCCTCAGATTTAGCCCTTCTTGGGCTGGAAGAAGATGTAATGCCACACCAGAACTCAG
AAACAAATTCATCTCATGCTCAAAGCCAAAAGGGCAAATCCTCACCCATTTGTTCTACAA
CTGGAGACGATAAACTTTGTGCAGACTCTGCATGTCAACAGAACACAGTGACTTCTAGTG
GCGATTTGGTTGCAAAACTGTGTGATAACATAGTTAGCGAGTCCGAAAGCACCACAGCAA
GGCAACCCAGCTCACAAGATCCACCCGATGCCTCCCACTGTGAAGACCCACAGGCTCATA
CAGTCACCTCTGACCCTGTAAGGGATACCCAGGAACGTGCGGATTTTTGTCCTTTCAAAG
TGGTGGATAACAAAGGCCAACGAAAAGATGTGAAACTAGATAAACCTTTAACAAATATGC
TTGAGGTGGTTTCACATCCACATCCAGTTGTCCCTAAAATGGAGAAAGAACTGGTGCCAG
ACCAGGCAGTAATATCAGACAGTACTTTCTCTCTGGCAAACAGTCCAGGCAGTGAATCAG
TAACCAAGGATGACGCACTTTCTTTTGTCCCCTCCCAGAAAGAAAAGGGAACAGCAACTC
CTGAACTACATACAGCTACAGATTATAGAGATGGCCCAGATGGAAATTCGAATGAGCCTG
ATACGCGGCCACTAGAAGACAGGGCAGTAGGCCTGTCCACATCCTCCACTGCTGCAGAGC
TTCAGCACGGGATGGGGAATACCAGTCTCACAGGACTTGGTGGAGAGCATGAGGGTCCCG
CCCCTCCAGCAATCCCAGAAGCTCTGAATATCAAGGGGAACACTGACTCTTCCCTGCAAA
GTGTGGGTAAGGCCACTTTGGCTTTAGATTCAGTTTTGACTGAAGAAGGAAAACTTCTGG
TGGTTTCAGAAAGCTCTGCAGCTCAGGAACAAGATAAGGATAAAGCGGTGACCTGTTCCT
CTATTAAGGAAAATGCTCTCTCTTCAGGAACTTTGCAGGAAGAGCAGAGAACACCACCTC
CTGGACAAGATACTCAACAATTTCATGAAAAATCAATCTCAGCTGACTGTGCCAAGGACA
AAGCACTTCAGCTAAGTAATTCACCGGGTGCATCCTCTGCCTTTCTTAAGGCAGAAACTG
AACATAACAAGGAAGTGGCCCCACAAGTCTCACTGCTGACTCAAGGTGGGGCTGCCCAGA
GCCTGGTGCCACCAGGAGCAAGTCTGGCCACAGAGTCAAGGCAGGAAGCCTTGGGGGCAG
AGCACAACAGCTCCGCTCTGTTGCCATGTCTGTTGCCAGATGGGTCTGATGGGTCCGATG
CTCTTAACTGCAGTCAGCCTTCTCCTCTGGATGTTGGAGTGAAGAACACTCAATCCCAGG
GAAAAACTAGTGCCTGTGAGGTGAGTGGAGATGTGACGGTGGATGTTACAGGGGTTAATG
CTCTACAAGGTATGGCTGAGCCCAGAAGAGAGAATATATCACACAACACCCAAGACATCC
TGATTCCAAACGTCTTGTTGAGCCAAGAGAAGAATGCCGTTCTAGGTTTGCCAGTGGCTC
TACAGGACAAAGCTGTGACTGACCCACAGGGAGTTGGAACCCCAGAGATGATACCTCTTG
ATTGGGAGAAAGGGAAGCTGGAGGGAGCAGACCACAGCTGTACCATGGGTGACGCTGAGG
AAGCCCAAATAGACGATGAAGCACATCCTGTCCTACTGCAGCCTGTTGCCAAGGAGCTCC
CCACAGACATGGAGCTCTCAGCCCATGATGATGGGGCCCCAGCTGGTGTGAGGGAAGTCA
TGCGAGCCCCGCCTTCAGGCAGGGAAAGGAGCACTCCCTCTCTACCTTGCATGGTCTCTG
CCCAGGACGCACCTCTGCCTAAGGGGGCAGACTTGATAGAGGAGGCTGCCAGCCGTATAG
TGGATGCTGTCATCGAACAAGTCAAGGCCGCTGGAGCACTGCTTACTGAGGGGGAGGCCT
GTCACATGTCACTGTCCAGCCCTGAGTTGGGTCCTCTCACTAAAGGACTAGAGAGTGCTT
TTACAGAAAAAGTGAGTACTTTCCCACCTGGGGAGAGCCTACCAATGGGCAGTACTCCTG
AGGAAGCCACGGGGAGCCTTGCAGGATGTTTTGCTGGAAGGGAGGAGCCAGAGAAGATCA
TTTTACCTGTCCAGGGGCCTGAGCCAGCAGCAGAAATGCCAGACGTGAAAGCTGAAGATG
AAGTGGATTTTAGAGCAAGTTCAATTTCTGAAGAAGTGGCTGTAGGGAGCATAGCTGCTA
CACTGAAGATGAAGCAAGGCCCAATGACCCAGGCGATAAACCGAGAAAACTGGTGTACAA
TAGAGCCATGCCCTGATGCAGCATCTCTTCTGGCTTCCAAGCAGAGCCCAGAATGTGAGA
ACTTCCTGGATGTTGGACTGGGCAGAGAGTGTACCTCAAAACAAGGTGTACTTAAAAGAG
AATCTGGGAGTGATTCTGACCTCTTTCACTCACCCAGTGATGACATGGACAGCATCATCT
TCCCAAAGCCAGAGGAAGAGCATTTGGCCTGTGATATCACCGGATCCAGTTCATCCACCG
ATGACACGGCTTCACTGGACCGACATTCTTCTCATGGCAGTGATGTGTCTCTCTCCCAGA
TTTTAAAGCCAAACAGGTCAAGAGATCGGCAAAGCCTTGATGGATTCTACAGCCATGGGA
TGGGAGCTGAGGGTCGAGAAAGTGAGAGTGAGCCTGCTGACCCAGGCGACGTGGAGGAGG
AGGAGATGGACAGTATCACTGAAGTGCCTGCAAACTGCTCTGTCCTAAGGAGCTCCATGC
GCTCTCTTTCTCCCTTCCGGAGGCACAGCTGGGGGCCTGGGAAAAATGCAGCCAGCGATG
CAGAAATGAACCACCGGAGTATGAGCTGGTGCCCCTCTGGTGTGCAGTACTCTGCTGGCC
TGAGTGCTGACTTTAATTACAGAAGTTTCAGTCTAGAAGGCTTGACAGGAGGAGCTGGTG
TCGGAAACAAGCCATCCTCATCTCTAGAAGTAAGCTCTGCAAATGCCGAAGAGCTCAGAC
ACCCATTCAGTGGTGAGGAACGGGTTGACTCTTTGGTGTCACTTTCAGAAGAGGATCTGG
AGTCAGACCAGAGAGAACATAGGATGTTTGATCAGCAGATATGTCACAGATCTAAGCAGC
AGGGATTTAATTACTGTACATCAGCCATTTCCTCTCCATTGACAAAATCCATCTCATTAA
TGACAATCAGCCATCCTGGATTGGACAATTCACGGCCCTTCCACAGTACCTTCCACAATA
CCAGTGCTAATCTGACTGAGAGTATAACAGAAGAGAACTATAATTTCCTGCCACATAGCC
CCTCCAAGAAAGATTCTGAATGGAAGAGTGGAACAAAAGTCAGTCGTACATTCAGCTACA
TCAAGAATAAAATGTCTAGCAGCAAGAAGAGCAAAGAAAAGGAAAAAGAAAAAGATAAGA
TTAAGGAGAAGGAGAAAGATTCTAAAGACAAGGAGAAAGATAAGAAGACTGTCAACGGGC
ACACTTTCAGTTCCATTCCTGTTGTGGGTCCCATCAGCTGTAGCCAGTGTATGAAGCCCT
TCACCAACAAAGATGCCTATACTTGTGCAAATTGCAGTGCTTTTGTCCACAAAGGCTGCC
GAGAAAGTCTAGCCTCCTGTGCAAAGGTCAAAATGAAGCAGCCCAAAGGGAGCCTTCAGG
CACATGACACATCATCACTGCCCACGGTCATTATGAGAAACAAGCCCTCACAGCCCAAGG
AGCGTCCTCGGTCCGCAGTCCTCCTGGTGGATGAAACCGCTACCACCCCAATATTTGCCA
ATAGACGATCCCAGCAGAGTGTCTCGCTCTCCAAAAGTGTCTCCATACAGAACATTACTG
GAGTTGGCAATGATGAGAACATGTCAAACACCTGGAAATTCCTGTCTCATTCAACAGACT
CACTAAATAAAATCAGCAAGGTCAATGAGTCAACAGAATCACTTACTGATGAGGGAGTAG
GTACAGACATGAATGAAGGACAACTACTGGGAGACTTTGAGATTGAGTCCAAACAGCTGG
AAGCAGAGTCTTGGAGTCGGATAATAGACAGCAAGTTTCTAAAACAGCAAAAGAAAGATG
TGGTCAAACGGCAAGAAGTAATATATGAGTTGATGCAGACAGAGTTTCATCATGTCCGCA
CTCTCAAGATCATGAGTGGTGTGTACAGCCAGGGGATGATGGCGGATCTGCTTTTTGAGC
AGCAGATGGTAGAAAAGCTGTTCCCCTGTTTGGATGAGCTGATCAGTATCCATAGCCAAT
TCTTCCAGAGGATTCTGGAGCGGAAGAAGGAGTCTCTGGTGGATAAAAGTGAAAAGAACT
TTCTCATCAAGAGGATAGGGGATGTGCTTGTAAATCAGTTTTCAGGTGAGAATGCAGAAC
GTTTAAAGAAGACATATGGCAAGTTTTGTGGGCAACATAACCAGTCTGTAAACTACTTCA
AAGACCTTTATGCCAAGGATAAGCGTTTTCAAGCCTTTGTAAAGAAGAAGATGAGCAGTT
CAGTTGTTAGAAGGCTTGGAATTCCAGAGTGCATATTGCTTGTAACTCAGCGGATTACCA
AGTACCCAGTTTTATTCCAAAGAATATTGCAGTGTACCAAAGACAATGAAGTGGAGCAGG
AAGATCTAGCACAGTCCTTGAGCCTGGTGAAGGATGTGATTGGAGCTGTAGACAGCAAAG
TGGCAAGTTATGAAAAGAAAGTGCGTCTCAATGAGATTTATACAAAGACAGATAGCAAGT
CAATCATGAGGATGAAGAGTGGTCAGATGTTTGCCAAGGAAGATTTGAAACGGAAGAAGC
TTGTACGTGATGGGAGTGTGTTTCTGAAGAATGCAGCAGGAAGGTTGAAAGAGGTTCAAG
CAGTTCTTCTCACTGACATTTTAGTTTTCCTTCAAGAAAAAGACCAGAAGTACATCTTTG
CATCATTGGACCAGAAGTCAACAGTGATCTCTTTAAAGAAGCTGATTGTGAGAGAAGTGG
CACATGAGGAGAAAGGTTTATTCCTGATCAGCATGGGGATGACAGATCCAGAGATGGTAG
AAGTCCATGCCAGCTCCAAAGAGGAACGAAACAGCTGGATTCAGATCATTCAGGACACAA
TCAACACCCTGAACAGAGATGAAGATGAAGGAATTCCTAGTGAGAATGAGGAAGAAAAGA
AAATGTTGGACACCAGAGCCCGAGAATTAAAAGAACAACTTCACCAGAAGGACCAAAAAA
TCCTACTCTTGTTGGAAGAGAAGGAGATGATTTTCCGGGACATGGCTGAGTGCAGCACCC
CTCTCCCAGAGGATTGCTCCCCAACACATAGCCCTAGAGTTCTCTTCCGCTCCAACACAG
AAGAGGCTCTCAAAGGAGGACCTTTAATGAAAAGTGCAATAAATGAGGTGGAGATCCTTC
AGGGTTTGGTGAGTGGAAATCTGGGAGGCACACTTGGGCCGACTGTCAGCAGCCCCATTG
AGCAAGATGTGGTCGGTCCCGTTTCCCTGCCCCGGAGAGCAGAGACCTTTGGAGGATTTG
ACAGCCATCAGATGAATGCTTCAAAAGGAGGCGAGAAGGAAGAGGGAGATGATGGCCAAG
ATCTTAGGAGAACGGAATCAGATAGTGGCCTAAAAAAGGGTGGAAATGCTAACCTGGTAT
TTATGCTTAAAAGAAACAGTGAGCAGGTTGTCCAGAGCGTTGTTCATCTCTACGAGCTCC
TCAGCGCTCTGCAGGGTGTGGTGCTGCAGCAGGACAGCTACATTGAGGACCAGAAACTGG
TGCTGAGCGAGAGGGCGCTCACTCGCAGCTTGTCCCGCCCGAGCTCCCTCATTGAGCAGG
AGAAGCAGCGCAGCCTGGAGAAGCAGCGCCAGGACCTGGCCAACCTGCAGAAGCAGCAGG
CCCAGTACCTCGAGGAGAAGCGCAGGCGCGAGCGTGAGTGGGAAGCTCGTGAGAGGGAGC
TGCGGGAGCGGGAGGCCCTCCTGGCCCAGCGCGAGGAGGAGGTGCAGCAGGGGCAGCAGG
ACCTGGAAAAGGAGCGGGAGGAGCTCCAGCAGAAGAAGGGCACATACCAGTATGACCTGG
AGCGACTGCGTGCTGCCCAGAAACAGCTTGAGAGGGAACAGGAGCAGCTGCGCCGGGAGG
CAGAGCGGCTCAGCCAGCGGCAGACAGAACGGGACCTGTGTCAGGTTTCCCATCCACATA
CCAAGCTGATGAGGATCCCATCGTTCTTCCCCAGTCCTGAGGAGCCCCCCTCGCCATCTG
CACCTTCCATAGCCAAATCAGGGTCATTGGACTCAGAACTTTCAGTGTCCCCAAAAAGGA
ACAGCATCTCTCGGACACACAAAGATAAGGGGCCTTTTCACATACTGAGTTCAACCAGCC
AGACAAACAAAGGACCAGAAGGGCAGAGCCAGGCCCCTGCGTCCACCTCTGCCTCTACCC
GCCTGTTTGGGTTAACAAAGCCAAAGGAAAAGAAGGAGAAAAAAAAGAAGAACAAAACCA
GCCGCTCTCAGCCCGGTGATGGTCCCGCGTCAGAAGTATCAGCAGAGGGTGAAGAGATCT
TCTGCTGACCCTCTTCCTCTCTGCTGAGGCAGCTGCCTCCTGATCCTGGCCAGCCCACCT
CTCCTGCTGTCCCCGCGTGCACAAGTCTCTTACACTGGACGCCCACTGCTCCTCAGCGTC
CAGTCCTCCTGGGCGGCCCCAGGTCCTGGACAATAAGCAACAGATGATATTGAGTGTCGG
GTGGGGAAGGAGGCCCAGACTCTGCTTCGGCCATGATTTGTGACTGCCCAGGACTCTCAG
GTTGGGCTGGCCCTACTCAGGATTACACTGAAAGTAATGGCCTCGTAAGTACAGGTGATG
GTTTTGGACACGTCAGGAATTCCTAAAGGCTGAAAGAGTGTATCCAAGTAAGGTCTGAAC
CTCCGAATGCCTTTTATTTGGGGGAACACAAAACCAAACAGCAGATGTTTTGGACTTGAT
CTGTGTACGTACATGGGGACCTGTCTGCATATACACACGGGGAATGCCAGAAGAAGGCCC
AGTCTGCACCAGGCGTCTGGTCAACTTAGCACAAGGGCAGTGCCTGGACGGACCCGGAGC
CCCCGCATATCAGCAGTTCACCCAGTACTCCTCAGAGACTGGTTTCCCTCTAAACCCATC
CCGGGCACATACCACCCGTGTTTTGCATGTATTTCTCATTTCATTTTAGGGATGACAAAC
ATTTGTGAAACCAGTGAGAGAAGGCTTGATGTGTATAAAAGACGTGATGTGCACCACCTC
GATCTCGGTGTTTCAGGCACTAAAGCAACAAAACAACCCATAGTATCTCATTCTGTCATC
AGATCCAGAAGAAATATCCTGGTTTTCCAGCATGTTTACCCACATGTTTTGGCCATGGAT
AAAGTGAAGAGGCCTACTCACCATTATCCCTGCAGCGTGACACCTTTTGATTGTCACTGA
CCACTCAGAAGGGGCCACGGCCTCCTGGCTGTGTTCCTGAGCCCCCGTCGTGCCTCTCCC
AGACAGCAGCTGTCTGGCCCTTGCTGGGTGAGGGCACACCACTGCCAGGGGTCAGCCTCG
CACCCAGGCCAGGCAGAAGCTGTGCTCTGAAGCTAGGACAGCTGGCTGAGAAGTGGGTTC
AGGCGAAGGGTGAAGCCATGTGTAGCAGTTCCTGCCAGTGCAGATCTGGAGAGGAGCTGG
CCCGGAAGGCGTGGTTGTGAAAGCGCCCTTCTTATGTTAGGAGGCCTTGGCAAAATTGGA
TTTCTTCAAAAATACATGTAAAGGTCTGTTGTTGAATTGTACTCTGCCCCTGGAAGCAGA
TACAGATGGCTGCCTGCTGCTCGGCTTTGCTTTTGCTTTTCCCACCGTGTTTTCATCTTT
GTTCACTTGAGGCTTTCCCCAGCTGGTGTGTGCAGGACAGTTCATGGTAATGTTGCCCTC
TGAGGCCCCGTACACCAGAAGGGAGGCCCTGGAAAATTTTGTGCTTCCAACGTGGCCTTC
AATTCTTGCTTTTTTGCCCCTCGGAAGCATGGGGCTTTTGAGCACACTTAAAAAAAGAAA
AATCTGTAACTTGGTGCTTATTGATGAATTGCAAGCTGGCCTTGCAGATGGAGATATTTA
TCTTTCAGTTTATTTGAAAGAGGTCTGGTTTAAAATTTGTAGCCTACATTTGTTTTATTT
ATTGTATTTGTGTGTTTGTGTTTGTTTTTTTTTAAGGGTGAGCCAGGTCTAGCCCAACAG
TCTAAACTATCCAGTCAATACCGAGTGAAGTGGCAGCCAGCACTGTTCACTCTGTGTCTT
TTGAAGTGCCTTGAAGGCCCAGATGAAATTTTAAAGGGAGGGGGTCCATGTCCTTCCCTC
CCCCACCCCGCCTCATTCTTTAATCAAAGGATGTCTTCTCCCTTGTTTGAGAATGAAGAA
ACTCGCCACCTCTGACCTACCTTTGCCTTTTTCTGTCATGGAGAATACTCACCCTTCAGA
AACAGACCAAAGGCCAAAACCTGCTGATTTTTCTATTGAAAATATGTCCCCTTGCAAAGA
CCCTAAACAAAAAGTTAAGTTTCTTTCTTTCACCTATTTGTACAACTCCAAGTTACAGCT
GAATCTGTCGTGACTTTCCTGAGATCTACCCGGGGCTTGGCTGTCTGTTCTGGGCACTGG
CTCCGAGTTCCCCTCCTGGGATTTGCAGGAGGGCAGTACTGAACCTGCATTCTTCTCCTT
GTAAATGTAGGCCGGGTGCCCCTGTTCTCCGGGTTTGGAACAATACGAGGTTGGTGCTGA
TGGGATTTACTTGCGTACGTGCTCTTCACAAAAACACCGTGGATGCTGAAGTTAGAGCAC
GTCGCCACAGAGCTTGACATCAATGTTAGAGGGTCTCTTACTCCCCGCCCAGCTGTGATG
TTTCATCTGCTTTGGTTGTTTTGGTGGTCTTTTTTAAAAATAGAGATTTCACATCTGCCC
AGACCCCACTCAAAACGATTTGGTCAGGTTCTGGTTGGACAAGTTTAAAATCAAAGTAGT
GCCCGGAATTCCCTCAAACCACCCAACTTCATCCAGGAATACAGTCTGCAGTGCAGCAAC
AGAACCGCTTACCAAGAACTGTGCTTACATACCTTTGTCATCTCTCTTCCCCCCTTGGAA
GTTGTCCTCAGGGGGATTTGTTCCTGTCCTGGGGATTTACCTGGGATGGTGGCTGCCTGT
GCTTTTGCTCATGGCCTTGACAGTGCTCTAGTTGCTGGATCTAATGGCCTGTCTTGGTTT
CTATCACATGAGAAGGGGTTGTTTTTTTGGGGTGACTCGGACTGAATTCCCCATACTGTT
TCCACGCCGGGACACCATGTTCTCCATCAAGCTAAAGAAATCACGTGCCTGAAACTGTGC
TTAAGTTTTGGGGGAAAGATGGAGTTCCTATCCAGAGCCCCCAGATTTCCAGAATCGAGT
GAGCTTCCTGGAAGGAGACTGCGTCTTCTCTCAATTCCAGTCATCTCAGTCGTTGTCGTT
AGGTGACATGTGCACTTTAAATGCTCTCATCGGTTGGCTTCATTTTCAAGACAATCAAAT
GTATTGACTGTGTTTTCTTCTTAGAAAATGGAGAGGGTTAAAAACATGCAAACTGCCACT
TTCAACCTTTGCCAGTATTCCCTCTACCCCCGTGAGAGCTATCTGGGGGGAAGAATCCTT
ACCAAGGTTTTTTTGGAAAGGTACGAATCTTAACTTTTTTCCCCTTCTGTGTCTCAGGGT
AATACTATTCAGAGTCGCCCCTTTGCTCATTTTCTCCCGTATTTGTTACCTTCCTGAGGC
CTCAGTATTAGTCGTGAGCACAAAGTTTTGAGACCTTTGGCGTTGTTTCTTGATGTGGGA
GGGGAGGTGTTAGTGCATGCAAGGGTTGAACTAGATAGACCCTGCCTTAGTAGAGGGTGG
GACTATAACCTTAGAGGCCAGAACTTGATCCAGAAGTTGCTGTCCACAGAAGTGCTTTCT
ATTTCATCATTTTTGTTTCTAGGGCTCTTTTTCTGTAGCCAGGTCTTCCCAAGGATTTTA
GTATTTGCATTGGAGTTGAGGTTTACTCTAATGATGGTGGCCCAGCTGTGCCCAGAGGAC
AGCCAGGCAGGCCCTGGGAGGGAGTTTAGAAAGACAGTCCTGGTGAATGGGCTTCAAGTG
GTCACAAAGAGGGTGGCTGTGAGGTGACCCCAGACACTGCAGAACGATGTGCACCCTCTG
CGTTTTGGATGTCCTTGGAATGTGGGAGCCTAGAAATAACCCTGTGGATGGAATTGGGGC
AGCGGCTGCTGGAGATCTGTGTGCCTTGCCTTCCTTCAGCAGGACCGTCTAGGTGCGCAG
CCACCTATGGATGCGTCCCAGCCAGCCCCGTCGCTCTCGTCCATCCTCAGAGACAAAGAA
GAGGGCAGGGAGTTTGGGCTTGGTTTTGAACTTTCCTTTCAATGTAGCAAAGCATTCCTA
GTTAACCAGAGCCTTGGAATCTACTGCCTGCTGGCCAGGCTTTAAAATGAAAAGTGTTTT
AATGCTGCCATAAAAGGGAGGCGGGGGGGAGGAAGGGAAAATAAAGGCATCTTTCCAAGT
ACTCATCTAATTTAATTGTCAAAAGATTGATAGGCCATGAATTACTTCTCCATCTCACTA
AGGGTTAAAGGCGTGCAACCCCCCACTGGCTGTGTCCCCTGCCACCGAAGTGAGTGACCT
GCCCTACAACCAGGTGGGACCACCTGTGCTGCAGTCCGGAGGGGCTTCTGCAGGAAGCAC
TCACCCCCCACACCTTCCCCGGCCTGAGCTTCCCCTACCTTTCGTCACCACCTGAGGGCA
TGAGCACAGGCCATGGGGCGTGCCTGGTGAGTCTGCCTGTGGTTCAGGCTTAGCCTGTGG
TCTCCTGTGTGCTGCTGCCCGCATGGGATGCGCAGGGGAGGCGTGGGGATCCGCAGGAGG
GTGGTTGGGATACACCGGATACCTCTGCTCTCATTGCTTGTTTGCAAATGCTCTATGGAC
ATTTGTGTGCTAAATCCTATTAAATAAAAAAGACGGGTTAAAACCCAGATGCTGTATATT
CATTTGTAATTATGTATAAAGTGAAGCAGTTTTAAACTGTAAAGATTTTTTTCAGTGTGT
TTTCTCGAATTTTGCCACAACATACTGGCTTCGTATTTTATTTATCTTTCTTTCTAGTTA
CCAGCTTCAGACCCTTGTAAAGTCTCCCTCAGCCCTTTCAAAAAATAATAAATTTCCTGT
GAAGTTCTGAAAAAAAAAAAAAAAAAA

Protein Sequence

>11214 : length: 2817
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAP
GHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQQALNFTRFLD
QSGPPSGDVNSLDKKLVLAFRHLKLPTEWNVLGTDQSLHDAGPRETLMHFAVRLGLLRLT
WFLLQKPGGRGALSIHNQEGATPVSLALERGYHKLHQLLTEENAGEPDSWSSLSYEIPYG
DCSVRHHRELDIYTLTSESDSHHEHPFPGDGCTGPIFKLMNIQQQLMKTNLKQMDSLMPL
MMTAQDPSSAPETDGQFLPCAPEPTDPQRLSSSEETESTQCCPGSPVAQTESPCDLSSIV
EEENTDRSCRKKNKGVERKGEEVEPAPIVDSGTVSDQDSCLQSLPDCGVKGTEGLSSCGN
RNEETGTKSSGMPTDQESLSSGDAVLQRDLVMEPGTAQYSSGGELGGISTTNVSTPDTAG
EMEHGLMNPDATVWKNVLQGGESTKERFENSNIGTAGASDVHVTSKPVDKISVPNCAPAA
SSLDGNKPAESSLAFSNEETSTEKTAETETSRSREESADAPVDQNSVVIPAAAKDKISDG
LEPYTLLAAGIGEAMSPSDLALLGLEEDVMPHQNSETNSSHAQSQKGKSSPICSTTGDDK
LCADSACQQNTVTSSGDLVAKLCDNIVSESESTTARQPSSQDPPDASHCEDPQAHTVTSD
PVRDTQERADFCPFKVVDNKGQRKDVKLDKPLTNMLEVVSHPHPVVPKMEKELVPDQAVI
SDSTFSLANSPGSESVTKDDALSFVPSQKEKGTATPELHTATDYRDGPDGNSNEPDTRPL
EDRAVGLSTSSTAAELQHGMGNTSLTGLGGEHEGPAPPAIPEALNIKGNTDSSLQSVGKA
TLALDSVLTEEGKLLVVSESSAAQEQDKDKAVTCSSIKENALSSGTLQEEQRTPPPGQDT
QQFHEKSISADCAKDKALQLSNSPGASSAFLKAETEHNKEVAPQVSLLTQGGAAQSLVPP
GASLATESRQEALGAEHNSSALLPCLLPDGSDGSDALNCSQPSPLDVGVKNTQSQGKTSA
CEVSGDVTVDVTGVNALQGMAEPRRENISHNTQDILIPNVLLSQEKNAVLGLPVALQDKA
VTDPQGVGTPEMIPLDWEKGKLEGADHSCTMGDAEEAQIDDEAHPVLLQPVAKELPTDME
LSAHDDGAPAGVREVMRAPPSGRERSTPSLPCMVSAQDAPLPKGADLIEEAASRIVDAVI
EQVKAAGALLTEGEACHMSLSSPELGPLTKGLESAFTEKVSTFPPGESLPMGSTPEEATG
SLAGCFAGREEPEKIILPVQGPEPAAEMPDVKAEDEVDFRASSISEEVAVGSIAATLKMK
QGPMTQAINRENWCTIEPCPDAASLLASKQSPECENFLDVGLGRECTSKQGVLKRESGSD
SDLFHSPSDDMDSIIFPKPEEEHLACDITGSSSSTDDTASLDRHSSHGSDVSLSQILKPN
RSRDRQSLDGFYSHGMGAEGRESESEPADPGDVEEEEMDSITEVPANCSVLRSSMRSLSP
FRRHSWGPGKNAASDAEMNHRSMSWCPSGVQYSAGLSADFNYRSFSLEGLTGGAGVGNKP
SSSLEVSSANAEELRHPFSGEERVDSLVSLSEEDLESDQREHRMFDQQICHRSKQQGFNY
CTSAISSPLTKSISLMTISHPGLDNSRPFHSTFHNTSANLTESITEENYNFLPHSPSKKD
SEWKSGTKVSRTFSYIKNKMSSSKKSKEKEKEKDKIKEKEKDSKDKEKDKKTVNGHTFSS
IPVVGPISCSQCMKPFTNKDAYTCANCSAFVHKGCRESLASCAKVKMKQPKGSLQAHDTS
SLPTVIMRNKPSQPKERPRSAVLLVDETATTPIFANRRSQQSVSLSKSVSIQNITGVGND
ENMSNTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQLLGDFEIESKQLEAESW
SRIIDSKFLKQQKKDVVKRQEVIYELMQTEFHHVRTLKIMSGVYSQGMMADLLFEQQMVE
KLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIKRIGDVLVNQFSGENAERLKKT
YGKFCGQHNQSVNYFKDLYAKDKRFQAFVKKKMSSSVVRRLGIPECILLVTQRITKYPVL
FQRILQCTKDNEVEQEDLAQSLSLVKDVIGAVDSKVASYEKKVRLNEIYTKTDSKSIMRM
KSGQMFAKEDLKRKKLVRDGSVFLKNAAGRLKEVQAVLLTDILVFLQEKDQKYIFASLDQ
KSTVISLKKLIVREVAHEEKGLFLISMGMTDPEMVEVHASSKEERNSWIQIIQDTINTLN
RDEDEGIPSENEEEKKMLDTRARELKEQLHQKDQKILLLLEEKEMIFRDMAECSTPLPED
CSPTHSPRVLFRSNTEEALKGGPLMKSAINEVEILQGLVSGNLGGTLGPTVSSPIEQDVV
GPVSLPRRAETFGGFDSHQMNASKGGEKEEGDDGQDLRRTESDSGLKKGGNANLVFMLKR
NSEQVVQSVVHLYELLSALQGVVLQQDSYIEDQKLVLSERALTRSLSRPSSLIEQEKQRS
LEKQRQDLANLQKQQAQYLEEKRRREREWEARERELREREALLAQREEEVQQGQQDLEKE
REELQQKKGTYQYDLERLRAAQKQLEREQEQLRREAERLSQRQTERDLCQVSHPHTKLMR
IPSFFPSPEEPPSPSAPSIAKSGSLDSELSVSPKRNSISRTHKDKGPFHILSSTSQTNKG
PEGQSQAPASTSASTRLFGLTKPKEKKEKKKKNKTSRSQPGDGPASEVSAEGEEIFC