ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11186

Name

RASSF1

Synonym

123F2|NORE2A|RASSF1A|RDA32|REH3P21;Ras association (RalGDS/AF-6) domain family member 1;RASSF1;Ras association (RalGDS/AF-6) domain family member 1

Definition

WUGSC:H_LUCA12.5|cardiac-specific ras association domain family 1 protein|pancreas-specific ras association domain family 1 protein|ras association domain-containing protein 1|tumor suppressor protein RDA32

Position

3p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

p53 pathway;PID Curated;200175

Disease

Pre-Eclampsia;FunDO

Disease

Cancers;KEGG DISEASE

Disease

esophageal cancer;GAD

Disease

Non-small cell lung cancer;KEGG DISEASE;H00014

Disease

Lung cancer;OMIM

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

breast cancer;GAD

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Infection;FunDO

Disease

head and neck cancer;GAD

Disease

Obesity;FunDO

Disease

Nasopharyngeal cancer;KEGG DISEASE;H00054

Disease

CANCER;GAD

Disease

Cancer;FunDO

Disease

lung cancer;GAD

Disease

Head and neck cancers;KEGG DISEASE

Disease

Bladder cancer;KEGG DISEASE;H00022

Disease

colorectal cancer;GAD

External Links

Links to cell senescence gene database

11186

Links to epithelial mesenchymal transition gene database

11186

Links to ovarian cancer gene database

11186

Links to endometrial cancer gene database

11186

Links to iHOP

11186

Sequence Information

Nucleotide Sequence

>11186 : length: 2038
GAGGCTGAAGAAAAGGGAATTAAATTTTGGCCATGTTCACTTGAAACGTCTTTTAGACAT
CCTAGTGAAGATTGCAAGTTCACCTGCCACTACCGCTGCCGCGCGCTCGTCTGCCTGGAC
TGTTGCGGGCCCCGGGACCTGGGCTGGGAACCCGCGGTGGAGCGGGACACGAACGTGGTG
GGGTCTGTGAGTGGAGCTCCGGAGCGATGAGGTCATTCCTGGGGGCGAAGCGTGCGTGTC
CCCGCCCCGGCGTTCCTGCCCCAATGAGACAAGAGCTAGATCCCGGCGATCTACGTTTCA
GTCTTAACGGTTGCGGCGCGGCTCTGGCCCGGGCGCACGCGCACACTGACACGCGTACAC
GCACGCACGCGACCGGGGCGGTGGTTGGCGGCTACGGACGCGCAGGACTGGGGGACGGGC
GGGTACGGCTATGGGCGAGGCGGAGGCGCCTTCTTTCGAAATGACCTGGAGCAGCACGAC
GAGCAGTGGCTACTGCAGCCAAGAGGACTCGGACTCGGAGCTCGAGCAGTACTTCACCGC
GCGAACCTCGCTAGCTCGCAGGCCGCGCCGGGACCAGGACGAGCCTGTGGAGTGGGAGAC
ACCTGACCTTTCTCAAGCTGAGATTGAGCAGAAGATCAAGGAGTACAATGCCCAGATCAA
CAGCAACCTCTTCATGAGCTTGAACAAGGACGGTTCTTACACAGGCTTCATCAAGGTTCA
GCTGAAGCTGGTGCGCCCTGTCTCTGTGCCCTCCAGCAAGAAGCCACCCTCCTTGCAGGA
TGCCCGGCGGGGCCCAGGACGGGGCACAAGTGTCAGGCGCCGCACTTCCTTTTACCTGCC
CAAGGATGCTGTCAAGCACCTGCATGTGCTGTCACGCACAAGGGCACGTGAAGTCATTGA
GGCCCTGCTGCGAAAGTTCTTGGTGGTGGATGACCCCCGCAAGTTTGCACTCTTTGAGCG
CGCTGAGCGTCACGGCCAAGTGTACTTGCGGAAGCTGTTGGATGATGAGCAGCCCCTGCG
GCTGCGGCTCCTGGCAGGGCCCAGTGACAAGGCCCTGAGCTTTGTCCTGAAGGAAAATGA
CTCTGGGGAGGTGAACTGGGACGCCTTCAGCATGCCTGAACTACATAACTTCCTACGTAT
CCTGCAGCGGGAGGAGGAGGAGCACCTCCGCCAGATCCTGCAGAAGTACTCCTATTGCCG
CCAGAAGATCCAAGAGGCCCTGCACGCCTGCCCCCTTGGGTGACCTCTTGTACCCCCAGG
TGGAAGGCAGACAGCAGGCAGCGCCAAGTGCGTGCCGTGTGAGTGTGACAGGGCCAGTGG
GGCCTGTGGAATGAGTGTGCATGGAGGCCCTCCTGTGCTGGGGGAATGAGCCCAGAGAAC
AGCGAAGTAGCTTGCTCCCTGTGTCCACCTGTGGGTGTAGCCAGGTATGGCTCTGCACCC
CTCTGCCCTCATTACTGGGCCTTAGTGGGCCAGGGCTGCCCTGAGAAGCTGCTCCAGGCC
TGCAGCAGGAGTGGTGCAGACAGAAGTCTCCTCAATTTTTGTCTCAGAAGTGAAAATCTT
GGAGACCCTGCAAACAGAACAGGGTCATGTTTGCAGGGGTGACGGCCCTCATCTATGAGG
AAAGGTTTTGGATCTTGAATGTGGTCTCAGGATATCCTTATCAGAGCTAAGGGTGGGTGC
TCAGAATAAGGCAGGCATTGAGGAAGAGTCTTGGTTTCTCTCTACAGTGCCAACTCCTCA
CACACCCTGAGGTCAGGGAGTGCTGGCTCACAGTACAGCATGTGCCTTAATGCTTCATAT
GAGGAGGATGTCCCTGGGCCAGGGTCTGTGTGAATGTGGGCACTGGCCCAGGTTCATACC
TTATTTGCTAATCAAAGCCAGGGTCTCTCCCTCAGGTGTTTTTTATGAAGTGCGTGAATG
TATGTAATGTGTGGTGGCCTCAGCTGAATGCCTCCTGTGGGGAAAGGGGTTGGGGTGACA
GTCATCATCAGGGCCTGGGGCCTGAGAGAATTGGCTCAATAAAGATTTCAAGATCCTC

Protein Sequence

>11186 : length: 344
MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERD
TNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG