ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11181

Name

TREH

Synonym

TRE|TREA;trehalase (brush-border membrane glycoprotein);TREH;trehalase (brush-border membrane glycoprotein)

Definition

alpha,alpha-trehalose glucohydrolase|trehalase

Position

11q23.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Metabolism of carbohydrates;Reactome;REACT:474

Pathway

trehalose degradation II (trehalase);BioCyc;PWY0-1182

Pathway

Digestion of dietary carbohydrate;PID Reactome;500675

Pathway

Starch and sucrose metabolism;KEGG PATHWAY;hsa00500

Disease

Trehalase deficiency;OMIM

External Links

Links to cell senescence gene database

11181

Links to epithelial mesenchymal transition gene database

11181

Links to ovarian cancer gene database

11181

Links to endometrial cancer gene database

11181

Links to iHOP

11181

Sequence Information

Nucleotide Sequence

>11181 : length: 1874
CCGAAGGTGCCTGGGCTTGCTCATTCAGTCACAGTCACAGCCACCATGCCAGGGAGGACC
TGGGAGCTGTGCCTGCTACTGCTGCTGGGGCTGGGACTGGGGTCCCAGGAGGCCCTACCC
CCACCCTGTGAGAGTGAGATTTACTGCCACGGGGAGCTCCTAAACCAAGTTCAAATGGCC
AAGCTCTACCAGGATGACAAGCAGTTTGTGGACATGCCACTGTCTATAGCTCCAGAACAA
GTCCTGCAGACCTTCACTGAGCTGTCCAGGGACCACAATCACAGCATCCCCAGGGAGCAG
CTGCAGGCGTTTGTCCACGAACACTTCCAGGCCAAGGGGCAGGAGCTGCAGCCCTGGACC
CCTGCAGACTGGAAAGACAGCCCCCAGTTCCTGCAGAAGATTTCAGATGCCAAACTGCGT
GCCTGGGCAGGGCAGCTGCATCAGCTCTGGAAGAAGCTGGGGAAGAAGATGAAGCCAGAG
GTTCTCAGCCACCCTGAGCGGTTCTCTCTCATCTACTCAGAACATCCCTTCATTGTGCCT
GGCGGTCGCTTTGTTGAGTTCTACTACTGGGACTCCTACTGGGTCATGGAGGGTCTGCTC
CTCTCAGAGATGGCTGAGACGGTGAAGGGCATGCTGCAGAACTTCTTGGACCTGGTGAAA
ACCTATGGGCATGTCCCCAATGGTGGGCGCGTGTACTACCTGCAGCGGAGCCAGCCCCCA
CTCTTGACCCTCATGATGGATTGCTACTTGACTCACACCAATGACACCGCCTTTCTACAG
GAAAACATTGAAACACTAGCCTTGGAATTGGACTTTTGGACCAAGAACAGGACTGTCTCT
GTGAGCTTGGAGGGAAAGAACTACCTCCTGAATCGCTATTATGTCCCTTATGGGGGACCC
AGGCCTGAGTCCTACAGCAAAGATGTGGAGTTGGCTGACACCTTGCCAGAAGGAGACCGG
GAGGCTCTGTGGGCTGAGCTCAAGGCTGGGGCTGAGTCTGGCTGGGACTTCTCTTCACGC
TGGCTCATTGGAGGCCCAAACCCCAACTCGCTTAGCGGCATCCGAACAAGCAAACTGGTG
CCTGTTGACCTGAATGCCTTCCTATGCCAAGCAGAGGAGCTGATGAGCAACTTCTATTCC
AGGCTGGGGAACGACTCCCAGGCCACGAAGTACAGAATCCTGCGGTCGCAGCGCTTGGCC
GCCCTGAACACAGTCCTGTGGGATGAGCAGACCGGAGCCTGGTTCGATTACGACCTTGAG
AAGAAGAAGAAAAACCGGGAGTTTTACCCATCCAACCTCACTCCACTCTGGGCCGGGTGT
TTCTCTGACCCTGGCGTGGCGGACAAGGCTCTGAAATACCTGGAGGACAACCGGATCCTG
ACTTACCAGTATGGGATCCCGACCTCTCTCCAGAAGACAGGCCAGCAGTGGGATTTCCCC
AATGCCTGGGCCCCCCTGCAGGACCTGGTCATCAGAGGCCTGGCCAAGGCACCTTTACGT
CGGGCCCAGGAAGTGGCTTTCCAGCTGGCTCAGAATTGGATCCGAACCAATTTTGATGTC
TACTCGCAGAAGTCAGCCATGTATGAGAAGTATGACGTCAGCAACGGTGGACAGCCCGGT
GGGGGAGGAGAATATGAAGTTCAGGAGGGATTTGGCTGGACGAATGGCGTGGTCCTGATG
CTGCTGGACCGCTATGGTGACCGGCTGACCTCAGGGGCCAAGCTGGCTTTCCTGGAGCCC
CACTGCCTGGCGGCCACCCTTCTGCCCAGCCTCCTGCTCAGCCTCCTGCCATGGTGACAG
CCCTCCTCTCCTCACCTGGCCCCAGCTCCTGCCCCATTAAACCTCTGCACCAGTAAAAAA
AAAAAAAAAAAAAA

Protein Sequence

>11181 : length: 583
MPGRTWELCLLLLLGLGLGSQEALPPPCESEIYCHGELLNQVQMAKLYQDDKQFVDMPLS
IAPEQVLQTFTELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKIS
DAKLRAWAGQLHQLWKKLGKKMKPEVLSHPERFSLIYSEHPFIVPGGRFVEFYYWDSYWV
MEGLLLSEMAETVKGMLQNFLDLVKTYGHVPNGGRVYYLQRSQPPLLTLMMDCYLTHTND
TAFLQENIETLALELDFWTKNRTVSVSLEGKNYLLNRYYVPYGGPRPESYSKDVELADTL
PEGDREALWAELKAGAESGWDFSSRWLIGGPNPNSLSGIRTSKLVPVDLNAFLCQAEELM
SNFYSRLGNDSQATKYRILRSQRLAALNTVLWDEQTGAWFDYDLEKKKKNREFYPSNLTP
LWAGCFSDPGVADKALKYLEDNRILTYQYGIPTSLQKTGQQWDFPNAWAPLQDLVIRGLA
KAPLRRAQEVAFQLAQNWIRTNFDVYSQKSAMYEKYDVSNGGQPGGGGEYEVQEGFGWTN
GVVLMLLDRYGDRLTSGAKLAFLEPHCLAATLLPSLLLSLLPW