ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11168

Name

PSIP1

Synonym

DFS70|LEDGF|PAIP|PSIP2|p52|p75;PC4 and SFRS1 interacting protein 1;PSIP1;PC4 and SFRS1 interacting protein 1

Definition

CLL-associated antigen KW-7|DFS 70|PC4 and SFRS1-interacting protein|dense fine speckles 70 kDa protein|lens epithelium-derived growth factor|transcriptional coactivator p52/p75|transcriptional coactivator p75/p52

Position

9p22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

HIV Infection;Reactome;REACT:6185

Disease

Leukemia;FunDO

Disease

Alopecia;FunDO

External Links

Links to cell senescence gene database

11168

Links to epithelial mesenchymal transition gene database

11168

Links to ovarian cancer gene database

11168

Links to endometrial cancer gene database

11168

Links to iHOP

11168

Sequence Information

Nucleotide Sequence

>11168 : length: 3396
CAGTGCTAGCGGGCGCCGAGCGGGAGCCGCGCGGGAGCAGCGCAGCTACGGCGGCGGCAG
CGGCGGCGCGGTTGCGATTCCGAGCCGTTGAGACGCCTCTGCGGCAGCTGGTGGCGCAGG
TGGCTTGCGTGGACGCGGGTAGAGGCGACCGGCCAGCAACCGCAGCGTCGGCGCCCGCGG
CCCCGGCAGCAGGCGCGTCGGGACGCCCCGAGGCATCCTCCCCCGCCCGCGGGCCCGGTA
GCTGGGCCCGCGTCCGCCGCCCGCATCCCCGCGCCGCCGCATCTCCTCGCCGCCTCCCGG
GCTTCGGACCCCCGGTCTCGCCCCCGAAACATGACTCGCGATTTCAAACCTGGAGACCTC
ATCTTCGCCAAGATGAAAGGTTATCCCCATTGGCCAGCTCGAGTAGACGAAGTTCCTGAT
GGAGCTGTAAAGCCACCCACAAACAAACTACCCATTTTCTTTTTTGGAACTCATGAGACT
GCTTTTTTAGGACCAAAGGATATATTTCCTTACTCAGAAAATAAGGAAAAGTATGGCAAA
CCAAATAAAAGAAAAGGTTTTAATGAAGGTTTATGGGAGATAGATAACAATCCAAAAGTG
AAATTTTCAAGTCAACAGGCAGCAACTAAACAATCAAATGCATCATCTGATGTTGAAGTT
GAAGAAAAGGAAACTAGTGTTTCAAAGGAAGATACCGACCATGAAGAAAAAGCCAGCAAT
GAGGATGTGACTAAAGCAGTTGACATAACTACTCCAAAAGCTGCCAGAAGGGGGAGAAAG
AGAAAGGCAGAAAAACAAGTAGAAACTGAGGAGGCAGGAGTAGTGACAACAGCAACAGCA
TCTGTTAATCTAAAAGTGAGTCCTAAAAGAGGACGACCTGCAGCTACAGAAGTCAAGATT
CCAAAACCAAGAGGCAGACCCAAAATGGTAAAACAGCCCTGTCCTTCAGAGAGTGACATC
ATTACTGAAGAGGACAAAAGTAAGAAAAAGGGGCAAGAGGAAAAACAACCTAAAAAGCAG
CCTAAGAAGGATGAAGAGGGCCAGAAGGAAGAAGATAAGCCAAGAAAAGAGCCGGATAAA
AAAGAGGGGAAGAAAGAAGTTGAATCAAAAAGGAAAAATTTAGCTAAAACAGGGGTTACT
TCAACCTCCGATTCTGAAGAAGAAGGAGATGATCAAGAAGGTGAAAAGAAGAGAAAAGGT
GGGAGGAACTTTCAGACTGCTCACAGAAGGAATATGCTGAAAGGCCAACATGAGAAAGAA
GCAGCAGATCGAAAACGCAAGCAAGAGGAACAAATGGAAACTGAGCAGCAGAATAAAGAT
GAAGGAAAGAAGCCAGAAGTTAAGAAAGTGGAGAAGAAGCGAGAAACATCAATGGATTCT
CGACTTCAAAGGATACATGCTGAGATTAAAAATTCACTCAAAATTGATAATCTTGATGTG
AACAGATGCATTGAGGCCTTGGATGAACTTGCTTCACTTCAGGTCACAATGCAACAAGCT
CAGAAACACACAGAGATGATTACTACACTGAAAAAAATACGGCGATTCAAAGTTAGTCAG
GTAATCATGGAAAAGTCTACAATGTTGTATAACAAGTTTAAGAACATGTTCTTGGTTGGT
GAAGGAGATTCCGTGATCACCCAAGTGCTGAATAAATCTCTTGCTGAACAAAGACAGCAT
GAGGAAGCGAATAAAACCAAAGATCAAGGGAAGAAAGGGCCAAACAAAAAGCTAGAGAAG
GAACAAACAGGGTCAAAGACTCTAAATGGAGGATCTGATGCTCAAGATGGTAATCAGCCA
CAACATAACGGGGAGAGCAATGAAGACAGCAAAGACAACCATGAAGCCAGCACGAAGAAA
AAGCCATCCAGTGAAGAGAGAGAGACTGAAATATCTCTGAAGGATTCTACACTAGATAAC
TAGGTTGACATACCTGGAATATAGAGAACACTTGAGAAGTTTGTAATGGTTTTCATTTGA
AATAGACTGCTGAAAGTTTTAAATTTTTATAAGCATAGGTTTGATGTTGAAAACTTGTTT
TGAGGGAGAAAATCCCTTTGTTTTAAAGTAAAGTAAACATTATCGCTAAGTGTACTTGTG
CAGTATTAACAGCTACATTATACAGTAAATGTGGGATAAAATCCATTTAGAAAATGTTAA
ACTGCTTTTCCAGACATGGTTGTAGCATATTTTCAATTAGTGTGTGTATGTTAATGTGTA
ATTGATAGTAGAACAAAGTTACATTTTTAAAACTGCTACTTGTATAAACCTTGCCTCTTT
TCCCAAATACTGTGGGTTTTGTGCATAGTTTTTACAAACCTTGGATTTACCAGACTGTCT
TTTCACTGTTTGTGGGTTTTGTAGAAGTTACACATTTTTATGGTAGATAAAATGTTACTT
CTATACAAGTACTCACTCCCTTTTTATCAAAAGTTAATTTTAATCTCACAGTCTACATTG
TGCTACATTATCCAGCTTCTTTGGAACAATGTGTGCTCTGTATGGTTTTTTTTGGTATGA
CAACTAATTAAGCAACTGACATGGAACTGAGAATTCTACAAACTATAAAACATTAATTTT
TGAAGGTAATTTAGTTTTGTGGCTGGGCATTCAGTGAAGTCTTAGGACTTCTTTGCAGAC
AACTGACTGGGTATATATAGGAATGAATCTGGCTTTAGGGTTAAATCATTTAAGGTCCTT
TTATAGGCAGGCACTAGTAACTAAAACTGAAAACTAAGTAAGTTTATTTTTGAGGAATGT
TGTTAAAAATGTCTTTAGGAAGTCACTAAAACTTAATTGGAAGAAAAAATCATGATGCTT
ATACAATAAATATGAATAAATGTTATATAAGGAAACTCACCTATTTGAAATCATGGCTAT
ATTGTTTTTATTTTCTAGATTCCAAAAATACAAACACTAGTTGTTCCAGCATTGTACTTT
GATAAGTCTGTACATTGACGTGTATGGACTAAATCCAGGGTAAAATCAATGTTACAAAAT
TTAAGGGTATGTTAACTAAAGGATAGCATTTCTAAGATATTTTGAATATTAGGGTCATTT
GGCACTTCTCAGCAAGTAGGATACTTCTCATGTTTTGAAATTATATGAATATGGAAAAAA
ATGGCTTAAGACCAGCGTCTCTGTATGACATTGTGTGGTTGACCCTCTGAGATAACTGTT
TTCATCTACAGAATTGCATTTTTGCTTTTAAAGAGGTCTTATAATGGAACTAGGAATCAC
CGTTTTGAGAGAACCTGCATATATACCAGTCATTATCTGTTTGGTCCTTATACAGTTTTA
ACTTACTTAGATTTATTCTAGTTAAGCCATAAGTTCAACGTGTAAACTTGTTTTCATTAA
AGAATTTTTCTATCAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>11168 : length: 530
MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
YSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKE
DTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKR
GRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKE
EDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRR
NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
NSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY
NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNG
GSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN