ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11156

Name

PTP4A3

Synonym

PRL-3|PRL-R|PRL3;protein tyrosine phosphatase type IVA, member 3;PTP4A3;protein tyrosine phosphatase type IVA, member 3

Definition

potentially prenylated protein tyrosine phosphatase|protein tyrosine phosphatase type IVA 3|protein-tyrosine phosphatase 4a3|protein-tyrosine phosphatase of regenerating liver 3

Position

8q24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by PRL;PID Curated;200006

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

11156

Links to epithelial mesenchymal transition gene database

11156

Links to ovarian cancer gene database

11156

Links to endometrial cancer gene database

11156

Links to iHOP

11156

Sequence Information

Nucleotide Sequence

>11156 : length: 3170
ACTTTTGTAGCGCCAGAGGCGACGGGCTCTGTCTGGTTGTAGCATCACAGAGCTTGATGG
GAACTTTCACTCTGAGACCCCTTTTATGGATAAGAAAACTGAGGCTGGGGGGCAGGAGCA
GCTTACCCCAGAGGTCCTCTCTCCCAGAGGGCTAGGGTGGGGATAAGCAGGGTCTCGGGG
GCAGCAAGACCCAGCTCCAAATGTGGTTTTTCTGCCTTCTGGCTGTGTGACTCAGAAGGG
TTGCTCAGCTTCTCTGTGCTGTTATGGTTTGTCAGTGCAGTGTGGCAGTGCCTCAGTTTC
CTCACCAGTACGCTAGGAGAGACCAGCGTAGCCAGCCACAGCGGGGTCGTGAGGATTAAG
TGAGGGGACAGCAGTGTCTGGCACGATGCTGTGTGCTGTGGACCCACCTGGGGTTCATGG
AGTGGGCCACGGGGCCCAGCCCTAAGCACTGCTGCGCCCAGGGTCGCCGCGCCTCCTGCT
GAGGGGTCCCCGTGCCACTGGCTCTCACCATTGCCCTCGCCTGCCGATGGCCTCTGCTGC
CCAGCCTGGGGCCAGCTCTACCGCCTGAGCCCCCTGCCCCACTCCAGGACTCACCGTACC
CCGATGGGGTAACGTGACACAGGCCCCACACGTCAGAGGCCGCTGTCCCCACGGCCACTG
CCCGTGACCCCTGGCCCAAGGCAGCTGGAGTTGGTTCAGTTCAAGTTCATTCTTCCTCTG
GCCCTTGGGGGCTTGGGGCCCACCTCTGAGTGAAGGGGGCTGTCTGCCCATCCACCAATG
TGGAGAGGGCGCCCCCGGTGTGGGGTCCAGCTCTGGACACTGCTTGGCGGCCGGGTTCAC
TTTGAGTTTTTAAGTTTTCTTTGCTGAGCTTTTTTGGTTGTTCTTTTTATTTTTTGCCTC
TTTATGACTATCCAGCTCTGAGAGACGGGAGTTTGGAGTTGCCCGCTTTACTTTGGTTGG
GTTGGGGGGGGCGGCGGGCTGTTTTGTTCCTTTTCTTTTTTAAGAGTTGGGTTTTCTTTT
TTAATTATCCAAACAGTGGGCAGCTTCCTCCCCCACACCCAAGTATTTGCACAATATTTG
TGCGGGGTATGGGGGTGGGTTTTTAAATCTCGTTTCTCTTGGACAAGCACAGGGATCTCG
TTCTCCTCATTTTTTGGGGGTGTGTGGGGACTTCTCAGGTCGTGTCCCCAGCCTTCTCTG
CAGTCCCTTCTGCCCTGCCGGGCCCGTCGGGAGGCGCCATGGCTCGGATGAACCGCCCGG
CCCCGGTGGAGGTGAGCTACAAACACATGCGCTTCCTCATCACCCACAACCCCACCAACG
CCACGCTCAGCACCTTCATTGAGGACCTGAAGAAGTACGGGGCTACCACTGTGGTGCGTG
TGTGTGAAGTGACCTATGACAAAACGCCGCTGGAGAAGGATGGCATCACCGTTGTGGACT
GGCCGTTTGACGATGGGGCGCCCCCGCCCGGCAAGGTAGTGGAAGACTGGCTGAGCCTGG
TGAAGGCCAAGTTCTGTGAGGCCCCCGGCAGCTGCGTGGCTGTGCACTGCGTGGCGGGCC
TGGGCCGGGCTCCAGTCCTTGTGGCGCTGGCCCTTATTGAGAGCGGGATGAAGTACGAGG
ACGCCATCCAGTTCATCCGCCAGAAGCGCCGCGGAGCCATCAACAGCAAGCAGCTCACCT
ACCTGGAGAAATACCGGCCCAAACAGAGGCTGCGGTTCAAAGACCCACACACGCACAAGA
CCCGGTGCTGCGTTATGTAGCTCAGGACCTTGGCTGGGCCTGGTCGTCATGTAGGTCAGG
ACCTTGGCTGGACCTGGAGGCCCTGCCCAGCCCTGCTCTGCCCAGCCCAGCAGGGGCTCC
AGGCCTTGGCTGGCCCCACATCGCCTTTTCCTCCCCGACACCTCCGTGCACTTGTGTCCG
AGGAGCGAGGAGCCCCTCGGGCCCTGGGTGGCCTCTGGGCCCTTTCTCCTGTCTCCGCCA
CTCCCTCTGGCGGCGCTGGCCGTGGCTCTGTCTCTCTGAGGTGGGTCGGGCGCCCTCTGC
CCGCCCCCTCCCACACCAGCCAGGCTGGTCTCCTCTAGCCTGTTTGTTGTGGGGTGGGGG
TATATTTTGTAACCACTGGGCCCCCAGCCCCTCTTTTGCGACCCCTTGTCCTGACCTGTT
CTCGGCACCTTAAATTATTAGACCCCGGGGCAGTCAGGTGCTCCGGACACCCGAAGGCAA
TAAAACAGGAGCCGTGGCCGTGTGTGTGGAGTGGGCTACAGCGTCAGGCGGGGCGGGCTG
GTGGCCTGGGGGCCCCAGAGGCTGCTGTCTGGATCCTGGGCTGGTGCCCAGGATGGGGCT
CCCGCGTGCTCTTGCGCTGCCCTCTGGTGGCCGCTCTGGGTCCTTGCACCCCGACCCAGG
GGCCAGCCTGCCCTGTCCTGTCCTGATACCGAGGTGGGAGCCCTGCCTTGGCCAGGGTGG
CCGTGTTGACGGTTCTTGGGACTGTGACATTGGAAGGCGAGGCAGGTCACCAGCACTGTC
CTCTGCAGGATGGGCTGGGATTCATTTGGCAGCTTCTCAGGGCCTGTGTCCGGCTGGTTG
GTCCCTGTGCTGCCCAAACCAGGTGTCCACATTTCCGGCTCCGAGGCGCAGAGAAGGGGG
CAGGTGGTGGCTTGGGTGGAGGAAGTCACCATCCATCAGCCCAGGGAGGGAGGGTGCCAC
CTGGGCACCTGGGGCTGGATGTGAGAGGCCTGGACCAGGGCCCGCCGGAGGGCGTGGACC
AGATGCTCATGTGTTCCTGGGTGCAGTGTCTGTGTTGGGGGCTGGCCCCACCCTGGGCCG
GGGTGCATGGAGGGCATGGCCCCAGCGGGGAGGAAGGTGGGCCTAGGGCTGGCTCCAGGG
TGTGGAGAGCCTGGGAGTGGTCTCCGTCCTGGGGCCCCAGGAGGTTCCCGCAAGGAGCGA
CTGGGGCAGGTGCTGGAGGAGGTCAGTGGACAAGATGGGGAGATGTGGAAACCCCAAAAG
CCCCTTCTCAGGCAGCCCTGCCCCCAAGACCGACAGATGGCTAAGGGGGCCGCAGACCTG
GCTCCCCCAGCTCCTGTGTGGAGAAAGGGCAACAGCTGTCCCGGATGGTTATTCTCTCCT
TTCCTCAAACACATTTGGAACTCAAGTAAATCCAATGCATGTTGGGTGAA

Protein Sequence

>11156 : length: 173
MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM