ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11116

Name

FGFR1OP

Synonym

FOP;FGFR1 oncogene partner;FGFR1OP;FGFR1 oncogene partner

Definition

fibroblast growth factor receptor 1 oncogene partner

Position

6q27

Gene Type

protein-coding

Pathways and Diseases

Pathway

Loss of Nlp from mitotic centrosomes;PID Reactome;500384

Pathway

Loss of proteins required for interphase microtubule organization from the centrosome;PID Reactome;500383

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Disease

Myeloproliferative disorder;OMIM

Disease

Lung cancer;FunDO

External Links

Links to cell senescence gene database

11116

Links to epithelial mesenchymal transition gene database

11116

Links to ovarian cancer gene database

11116

Links to endometrial cancer gene database

11116

Links to iHOP

11116

Sequence Information

Nucleotide Sequence

>11116 : length: 3736
TTTGGCTGCGTCGGCCGCGTAGCCCGCGCGCGGAGCGTACCCTGCTGCGGCCGTTGGCCG
TTAGCGCGGCTTCGGCGGTTGTCTTGGAGAAGCAAGATGGCGGCGACGGCGGCCGCAGTG
GTGGCCGAGGAGGACACGGAGCTGCGGGACCTGCTGGTGCAGACGCTGGAGAACAGCGGG
GTCCTGAACCGCATCAAGGCTGAACTCCGAGCAGCTGTGTTTTTAGCACTAGAGGAGCAA
GAAAAAGTAGAGAACAAAACTCCTTTAGTTAATGAGAGCCTGAAAAAGTTTTTAAATACC
AAAGACGGTCGTTTAGTGGCTAGTCTTGTTGCAGAATTTCTTCAGTTTTTTAACCTTGAC
TTTACTTTGGCTGTTTTTCAACCTGAAACTAGCACACTGCAAGGTCTCGAAGGTCGAGAG
AATTTAGCCCGAGATTTAGGTATAATTGAAGCAGAAGGTACTGTGGGTGGACCCTTATTA
TTAGAAGTGATCAGGCGCTGTCAACAGAAAGAAAAAGGGCCAACCACTGGGGAAGGTGCA
CTTGATCTATCTGATGTACATTCTCCACCAAAGTCACCAGAGGGAAAAACAAGTGCACAG
ACAACACCAAGTAAGATACCAAGGTATAAAGGACAAGGTAAGAAGAAGACAAGCGGGCAG
AAGGCTGGTGACAAGAAGGCCAATGATGAGGCCAATCAGAGTGATACAAGTGTCTCCTTG
TCAGAACCCAAGAGCAAAAGCAGCCTTCACTTACTGTCCCATGAAACAAAAATTGGATCT
TTTCTAAGCAACAGAACTTTAGATGGCAAAGACAAAGCTGGCCTTTGTCCAGATGAAGAT
GATATGGAAGGAGATTCTTTCTTTGATGATCCCATTCCTAAGCCAGAGAAAACTTACGGT
TTGAGGAAGGAACCTAGGAAGCAAGCAGGAAGTCTGGCCTCGCTCTCGGATGCACCCCCC
TTAAAAAGTGGACTCAGCTCCCTGGCGGGAGCCCCTTCTTTAAAAGACTCTGAGAGTAAA
AGGGGAAATACAGTTTTGAAAGATCTGAAATTGATCAGTGATAAAATTGGATCACTTGGA
TTAGGAACTGGAGAAGATGATGACTATGTTGATGATTTTAATAGTACCAGCCATCGCTCA
GAGAAAAGTGAGATAAGTATTGGTGAAGAGATAGAAGAAGACCTTTCTGTGGAAATAGAT
GACATCAATACCAGTGATAAGCTTGATGACCTCACACAAGATCTGACTGTATCCCAGCTC
AGTGATGTTGCGGATTATCTGGAAGATGTTGCATAGACACGAAGAAGGAAGTATTCTAAT
TAACAAGGACAGAGGACTGACCGGTTCCATTTTTTTTTTTTCCAGACAATCACTCAGCTG
GAATGTCTGCTCTCTATTGGTGCCTTGCATTTCAAAAACACTGCAGATATTTTTTAAAAG
TAATTTTCATTTTACTAAACAAAATACTTCCTATTTGAGCCCATGTGTGGAAGATTTAAT
ATTCTTAATTTAACTGTACATTTCTTTATGGAAATTGATTATCTACACTCAGTTTCATTA
CAGGGAAGGAACCCATGAAAACATCAGTGTTAAGAGCATGATGAAAGGTGTCAATAAAGC
CGTAGGATCGCGCAACCCTTTGTGTGTGTGGCTGCTGGTACGTGTGATCTTTGAAAACCT
TGGCTTTAGCCCTCTGGAATCAGAGCTTACCCACCATAGTATATTTTGATATTAGGTGGT
TCTACACATAGTTGGCAAAATGACTTGGTAAATTTGTAATGCTGAAGTATATTAGTATAA
GTTAAATTTGATGTGTCAACTTTATTTTGTATTTCCTTCCATTTGGAAGGTTTGTTAGAC
CATTAAGGTTATATTAAAGTACTCTTGTGTGTGCTATTTAGTTTTGCTTGTTTTAAAGAA
ATCTAGAAGTGGTTATGAGTTTTAATTCATAGAATTGTCAATAACATAACATTTGCAATC
GTCATTCCTCCTGTTATCCATGTAAGCAGCTTTAGTCGTAGGTTCTCTTCATTATAATTT
ATTATCTGTAAAGATTCCTTGAAACTTAAATGCATCTGAAACCATTAAGCAGTGCTTTTA
TTTCAGATCTGTAAGTTAATTGTATTAAAATCCAAATTGGAATGAAATAGTAGTAATGGC
CTAAGACCATGTTCAGTTTGACAAGCTTTATATACTGTACATAATTTCATTGTAACCCTT
AAAAATAGAGCCAATAATAGAATTTCCACAGTCTCATTTATACGGTTAAAGCATTATTGC
TATTATGTAGGTCACGGATGTTTATAATACTAAAGTATTTTAAAATGTGCAAGTAGAAAA
AACAGTAGAAAGTGATGCATGCATATTTATATATAAGTAAAGCAGGATTGTGCTGTTTTT
GCACTTTATAATTTCAATTAAGTTGCGGCTTTTTACTACAAGTTAACTTTATTAGTAAAA
GGAGCAAATTAGACCTAATTCATTGATCTCGGTTAAGTGAGCAGACTGCATGACTTGTGT
AATGCCAGTTTCTCATTTCATATTAGCCTAAATATTACAGAAATTACTCCTTGGGCTCTA
AAATGTAGAGGAAATGAAAATGTAAGGATTAAGGCTGTGTAACAGAATCTGGCTTTTTAA
AATTTAAGTGAAACTAAGCTGTAAACATCAAGAGGAAGTAGGACATAAACTGGGCCGGTA
CAGCCTGGGAGCCCTGTGTATTTCTGCCCTCCGTCTGTGAGCTGCTATCTCAGTCTCCTT
CAGCTCTTCATGTCTTAGTAAACAGCACCACGTGCAGATGTAATCTTGTTGCAGTCCCCC
AGTGTGGTTGTTATAAAATGCATTTCTTTGTAAGTCATCTCTGTAAACAGTCACTTTCTA
AAAGCACTATAGTTCTGGTCCCCTGGAATCTGGATCACATGTATGATTTATTTTTAATAT
TTGATAGGAACTAGGTTTCAGTGAAATGATTTGAAAGCATAGCAGGATGTGGCTTTTTAA
ATTTATGAAACTTTCGAACAGTAGCAACTGAAATTTGTCACTTTTCTGTTACGCAGAGAA
TCAGACCTTTTGATAATATTTGGGAGGGTAAAAGAAATATGCCAAATATGAAACTTTTTT
GTCAGCACTACATACATCTTTTTTTTGCGGGGGGCGGGGGGGACAGAGTCTCACTGTGTC
ACTCAGACTGGAGTACAGTGATGCGATCTCGGCTCACTGCAACCTCCGCCTCCTGGGTTC
AAGCGATTCTCCTGCTTCAGCCTCCTGAGTAGCTGGGATTACAGGTGCACACCACCACGC
CCGGCTAATTTTTGTATTTTTAGTAGAGATGGGGTTTCACCATGTTGGTCAGGCTGGTCT
TGAACTCCTGACCTCGTTCCTGCCTTAGCCTCCTAAAGTGCCGGGATTACAGGCGTGAAC
CACCGCACCTGGCCAGTACTACATCCATTTTATTGAATGATTTTGAATGACTTAAAGTTC
AACTATGAAAAAGCTTTCTTTTCACATGTACTTTTTGATTAGGTATTATCAACTTATGAA
ACTTGAAGATGTGAAGTGACAGGTTTTGCATGTGATGAGTGTTTTCTGTTAAAAAATAAA
TATTGAAATATTAACCCATTAAATACATTTTTATGGTAACCTATGTTTTACAGTGGAGTT
TTAAAAATGCTAGGTCTTTCTTTCATTTTATTGATAACTACAAATGAATAAAAAGCATTT
ATTCTCTTTGTTGATA

Protein Sequence

>11116 : length: 399
MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE
SLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAE
GTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKIPRYKGQ
GKKKTSGQKAGDKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDK
AGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAP
SLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIE
EDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA