ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11065

Name

UBE2C

Synonym

UBCH10|dJ447F3.2;ubiquitin-conjugating enzyme E2C;UBE2C;ubiquitin-conjugating enzyme E2C

Definition

cyclin-selective ubiquitin carrier protein|mitotic-specific ubiquitin-conjugating enzyme|ubiquitin-conjugating enzyme E2 C|ubiquitin-protein ligase C

Position

20q13.12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Autodegradation of Cdh1 by Cdh1:APC/C;PID Reactome;500401

Pathway

Ubiquitin proteasome pathway;PANTHER;P00060

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

APC-Cdc20 mediated degradation of Nek2A;Reactome;REACT:8017

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

Cdc20:Phospho-APC/C mediated degradation of Cyclin A;Reactome;REACT:6850

Pathway

Regulation of APC/C activators between G1/S and early anaphase;PID Reactome;500391

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

APC/C-mediated degradation of cell cycle proteins;PID Reactome;500390

Pathway

Phosphorylation of the APC/C;PID Reactome;500395

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

11065

Links to epithelial mesenchymal transition gene database

11065

Links to ovarian cancer gene database

11065

Links to endometrial cancer gene database

11065

Links to iHOP

11065

Sequence Information

Nucleotide Sequence

>11065 : length: 901
CCAGGAGCTCAGACCGCTCTTTGAGACTCTCCCGAAGGAGAATGGGAGGGTAGGGGCGCT
GCCAGACTCCTTCCCTGGTGGGCCTAGATGAAGACGCTCAAGGACCCTCGTGACTTGGCC
GAGACAGGGGAAGGGAGAAGTTGAGTCGGGCAAGGAAGAGATGCTAAAGCCTGGGGAATT
AAGAACATGCCAGAATCATCCCGAGGGAGTCTGGAATTAGGGAGGGTGAGGACTCGCTAG
GATCGTCCTGTGGATCTGGCTACAGCAGGAGCTGATGACCCTCATGATGTCTGGCGATAA
AGGGATTTCTGCCTTCCCTGAATCAGACAACCTTTTCAAATGGGTAGGGACCATCCATGG
AGCAGCTGGAACAGTATATGAAGACCTGAGGTATAAGCTCTCGCTAGAGTTCCCCAGTGG
CTACCCTTACAATGCGCCCACAGTGAAGTTCCTCACGCCCTGCTATCACCCCAACGTGGA
CACCCAGGGTAACATATGCCTGGACATCCTGAAGGAAAAGTGGTCTGCCCTGTATGATGT
CAGGACCATTCTGCTCTCCATCCAGAGCCTTCTAGGAGAACCCAACATTGATAGTCCCTT
GAACACACATGCTGCCGAGCTCTGGAAAAACCCCACAGCTTTTAAGAAGTACCTGCAAGA
AACCTACTCAAAGCAGGTCACCAGCCAGGAGCCCTGACCCAGGCTGCCCAGCCTGTCCTT
GTGTCGTCTTTTTAATTTTTCCTTAGATGGTCTGTCCTTTTTGTGATTTCTGTATAGGAC
TCTTTATCTTGAGCTGTGGTATTTTTGTTTTGTTTTTGTCTTTTAAATTAAGCCTCGGTT
GAGCCCTTGTATATTAAATAAATGCATTTTTGTCCTTTTTTAGACAAAAAAAAAAAAAAA
A

Protein Sequence

>11065 : length: 179
MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLF
KWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKE
KWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP