ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

11040

Name

PIM2

Synonym

Pim-2 proto-oncogene, serine/threonine kinase;PIM2;Pim-2 proto-oncogene, serine/threonine kinase

Definition

pim-2 oncogene|pim-2h|proto-oncogene Pim-2 (serine threonine kinase)|serine/threonine protein kinase pim-2|serine/threonine-protein kinase pim-2

Position

Xp11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Leukemia;FunDO

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

11040

Links to epithelial mesenchymal transition gene database

11040

Links to ovarian cancer gene database

11040

Links to endometrial cancer gene database

11040

Links to iHOP

11040

Sequence Information

Nucleotide Sequence

>11040 : length: 2234
AACTGGCTCCGATTGGCTGTGGTACAGCAGGTGCCGCGTCCGGATTGATCAAAGCCAGGT
GGGCGGGGCTGTCGCCCAGGGTGACTCTCCCGGGAGGCGCGTGCCCAGGCTCAGTAGCAT
TGGGGCTGGCGCGCGCGGCGAATCTCAACGCTGCGCCGTCTGCGGGCGCTTCCGGGCCAC
CAGTTTCTCTGCTTTCCACCCTGGCGCCCCCCAGCCCTGGCTCCCCAGCTGCGCTGCCCC
GGGCGTCCACGCCCTGCGGGCTTAGCGGGTTCAGTGGGCTCAATCTGCGCAGCGCCACCT
CCATGTTGACCAAGCCTCTACAGGGGCCTCCCGCGCCCCCCGGGACCCCCACGCCGCCGC
CAGGAGGCAAGGATCGGGAAGCGTTCGAGGCCGAGTATCGACTCGGCCCCCTCCTGGGTA
AGGGGGGCTTTGGCACCGTCTTCGCAGGACACCGCCTCACAGATCGACTCCAGGTGGCCA
TCAAAGTGATTCCCCGGAATCGTGTGCTGGGCTGGTCCCCCTTGTCAGACTCAGTCACAT
GCCCACTCGAAGTCGCACTGCTATGGAAAGTGGGTGCAGGTGGTGGGCACCCTGGCGTGA
TCCGCCTGCTTGACTGGTTTGAGACACAGGAGGGCTTCATGCTGGTCCTCGAGCGGCCTT
TGCCCGCCCAGGATCTCTTTGACTATATCACAGAGAAGGGCCCACTGGGTGAAGGCCCAA
GCCGCTGCTTCTTTGGCCAAGTAGTGGCAGCCATCCAGCACTGCCATTCCCGTGGAGTTG
TCCATCGTGACATCAAGGATGAGAACATCCTGATAGACCTACGCCGTGGCTGTGCCAAAC
TCATTGATTTTGGTTCTGGTGCCCTGCTTCATGATGAACCCTACACTGACTTTGATGGGA
CAAGGGTGTACAGCCCCCCAGAGTGGATCTCTCGACACCAGTACCATGCACTCCCGGCCA
CTGTCTGGTCACTGGGCATCCTCCTCTATGACATGGTGTGTGGGGACATTCCCTTTGAGA
GGGACCAGGAGATTCTGGAAGCTGAGCTCCACTTCCCAGCCCATGTCTCCCCAGACTGCT
GTGCCCTAATCCGCCGGTGCCTGGCCCCCAAACCTTCTTCCCGACCCTCACTGGAAGAGA
TCCTGCTGGACCCCTGGATGCAAACACCAGCCGAGGATGTACCCCTCAACCCCTCCAAAG
GAGGCCCTGCCCCTTTGGCCTGGTCCTTGCTACCCTAAGCCTGGCCTGGCCTGGCCTGGC
CCCCAATGGTCAGAAGAGCCATCCCATGGCCATGTCACAGGGATAGATGGACATTTGTTG
ACTTGGTTTTACAGGTCATTACCAGTCATTAAAGTCCAGTATTACTAAGGTAAGGGATTG
AGGATCAGGGGTTAGAAGACATAAACCAAGTCTGCCCAGTTCCCTTCCCAATCCTACAAA
GGAGCCTTCCTCCCAGAACCTGTGGTCCCTGATTCTGGAGGGGGAACTTCTTGCTTCTCA
TTTTGCTAAGGAAGTTTATTTTGGTGAAGTTGTTCCCATTCTGAGCCCCGGGACTCTTAT
TCTGATGATGTGTCACCCCACATTGGCACCTCCTACTACCACCACACAAACTTAGTTCAT
ATGCTCTTACTTGGGCAAGGGTGCTTTCCTTCCAATACCCCAGTAGCTTTTATTTTAGTA
AAGGGACCCTTTCCCCTAGCCTAGGGTCCCATATTGGGTCAAGCTGCTTACCTGCCTCAG
CCCAGGATTCTTTATTCTGGGGGAGGTAATGCCCTGTTGTTACCCCAAGGCTTCTTTTTT
TTTTTTTTTTTTTTGGGTGAGGGGACCCTACTCTGTTATCCCAAGTGCTCTTATTCTGGT
GAGAAGAACCTTACTTCCATAATTTGGGAAGGAATGGAAGATGGACACCACCGGACACCA
CCAGACACTAGGATGGGATGGATGGTTTTTTGGGGGATGGGCTAGGGGAAATAAGGCTTG
CTGTTTGTTCTCCTGGGGCGCTCCCTCCAACTTTTGCAGATTCTTGCAACCTCCTCCTGA
GCCGGGATTGTCCAATTACTAAAATGTAAATAATCACGTATTGTGGGGAGGGGAGTTCCA
AGTGTGCCCTCCTCTCTTCTCCTGCCTGGATTATTTAAAAAGCCATGTGTGGAAACCCAC
TATTTAATAAAAGTAATAGAATCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

Protein Sequence

>11040 : length: 311
MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP