ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10987

Name

COPS5

Synonym

CSN5|JAB1|MOV-34|SGN5;COP9 signalosome subunit 5;COPS5;COP9 signalosome subunit 5

Definition

38 kDa Mov34 homolog|COP9 constitutive photomorphogenic homolog subunit 5|COP9 signalosome complex subunit 5|jun activation domain-binding protein 1|signalosome subunit 5

Position

8q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

hypoxia-inducible factor in the cardivascular system;PID BioCarta;100145

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Hypoxic and oxygen homeostasis regulation of HIF-1-alpha;PID Curated;200122

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

10987

Links to epithelial mesenchymal transition gene database

10987

Links to ovarian cancer gene database

10987

Links to endometrial cancer gene database

10987

Links to iHOP

10987

Sequence Information

Nucleotide Sequence

>10987 : length: 1510
GACTATACCACTCCCATACCCTATAACTTTGTTTGTTCTATTTCACACATATAATTTTCC
GAGACAAGATGTTCTCATTTAAGCAACAAGAAGATTCGTCTCTCGCTATTACTGTAACTG
CTGTTTATATCGTCATGTCCCGGAAAGGTCCCTGTCTTCCCTGAATGGTCTCTACCAACT
TCACCTCCGGTTCTAGGTGTCATGGCTGCCCCAAGAGTCTAGGTAAGAGTTTGTTCCCGT
GGTGCGGAGGGTCAAGGCCCACACCCGGAAACCTAGCGAGGTAAAGTTGCGTCTTGGTTG
TAGAGACGACAACTTCTCCGCTTCCTCGGCGATGGCGGCGTCCGGGAGCGGTATGGCCCA
GAAAACCTGGGAACTGGCCAACAACATGCAGGAAGCTCAGAGTATCGATGAAATCTACAA
ATACGACAAGAAACAGCAGCAAGAAATCCTGGCGGCGAAGCCCTGGACTAAGGATCACCA
TTACTTTAAGTACTGCAAAATCTCAGCATTGGCTCTGCTGAAGATGGTGATGCATGCCAG
ATCGGGAGGCAACTTGGAAGTGATGGGTCTGATGCTAGGAAAGGTGGATGGTGAAACCAT
GATCATTATGGACAGTTTTGCTTTGCCTGTGGAGGGCACTGAAACCCGAGTAAATGCTCA
GGCTGCTGCATATGAATACATGGCTGCATACATAGAAAATGCAAAACAGGTTGGCCGCCT
TGAAAATGCAATCGGGTGGTATCATAGCCACCCTGGCTATGGCTGCTGGCTTTCTGGGAT
TGATGTTAGTACTCAGATGCTCAATCAGCAGTTCCAGGAACCATTTGTAGCAGTGGTGAT
TGATCCAACAAGAACAATATCCGCAGGGAAAGTGAATCTTGGCGCCTTTAGGACATACCC
AAAGGGCTACAAACCTCCTGATGAAGGACCTTCTGAGTACCAGACTATTCCACTTAATAA
AATAGAAGATTTTGGTGTACACTGCAAACAATATTATGCCTTAGAAGTCTCATATTTCAA
ATCCTCTTTGGATCGCAAATTGCTTGAGCTGTTGTGGAATAAATACTGGGTGAATACGTT
GAGTTCTTCTAGCTTGCTTACTAATGCAGACTATACCACTGGTCAGGTCTTTGATTTGTC
TGAAAAGTTAGAGCAGTCAGAAGCCCAGCTGGGACGAGGGAGTTTCATGTTGGGTTTAGA
AACGCATGACCGAAAATCAGAAGACAAACTTGCCAAAGCTACAAGAGACAGCTGTAAAAC
TACCATAGAAGCTATCCATGGATTGATGTCTCAGGTTATTAAGGATAAACTGTTTAATCA
AATTAACATCTCTTAAACAGTCTCTGAGAAGTACTTTACCTGAAAGACAGTATGAGAAAA
ATATTCAAGTAACACTTTAAAACCAGTTACCCAAAATCTGATTAGAAGTATAAGGTGCTC
TGAAGTGTCCTAAATATTAATATCCTGTAATAAAGCTCTTTAAAATGAAAAAAAAAAAAA
AAAAAAAAAA

Protein Sequence

>10987 : length: 334
MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISAL
ALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAY
IENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGK
VNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLEL
LWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS