ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10962

Name

MLLT11

Synonym

AF1Q;myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11;MLLT11;myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11

Definition

ALL1 fused gene from chromosome 1q|ALL1-fused gene from chromosome 1q|protein AF1q

Position

1q21

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10962

Links to epithelial mesenchymal transition gene database

10962

Links to ovarian cancer gene database

10962

Links to endometrial cancer gene database

10962

Links to iHOP

10962

Sequence Information

Nucleotide Sequence

>10962 : length: 2180
GGCGCACTGCTCCCCTCTGGACTGCGGAGGCACTGCACTGCGCGGGACGTGGGAGGGTGC
CTCTGCAGCCCCTCAAGGCCGCCGCCCCTGCGGGGAGAACTGGAGAATGCGGACACCTAG
ATGAGGCCCTGGCACCCAAGCTGGGGCCCCCGGAATCTCACGTTCCCTTTACTCGCCAGG
CATTTCGGGGCAAAACGAAGCGGAGCCCCCCAAACCCCCAGACCTAACCAAGTTCAGAGA
TTCGCAGAAGCACGCCCCCCACCCCAAATTTATTGTGCTCTACCCAAAATGGAATAGGAC
TAGGTTTATTTACCCATTGTGAGGGTAGAGAGGCGAGTCTGGAGGAGCAGGGATTGGGAG
AAGGGGTGGAAAAATACTCTGATTCTTAAAAATACTTTGTAACCTAAAGTCCTTAAATTG
TGGAAGAAAGGAATACTCCTCCTTTCCATTGTAGTCTAGAGTTAAGATTTCAAATCCATA
AATTAGAGGACCTAAAATTAGAGGGCAATTAACTGCTCATTCATTGGGCCCCCAGTCAGC
ACGGGGGTGCTGGAAGAGATCGGGAATAATAGCGCAGACCAATGAGCCTAGGGAGATGCT
TTCATCGTCTCTCCTTCCCTCAAGTGTTCTGGAACCTATCATTTGAATTAGCCGAGTCAG
GCAGGAGGGGGCGGGGAATCCTTCCGCCCTTCTTAGGAGGGGCTGCATTGCAGGGGGAGA
GTGAACTGACAGACTCAGTCACTGAAGAGGGAAAAGGAGTGAGAAGACAAAGCCGTCAAA
GCCCCAACAGCTTTGTATTTCTCCAGCCCGGCGCAGACCCCGGAGCTCCCGAGGCACTCC
CTCCATCTTTGGAACACGCCAGTAATTGATTGATAACAGGAAGCTATGAGGGACCCTGTG
AGTAGCCAGTACAGTTCCTTTCTTTTCTGGAGGATGCCCATCCCAGAACTGGATCTGTCG
GAGCTGGAAGGCCTGGGTCTGTCAGATACAGCCACCTACAAGGTCAAAGACAGCAGCGTT
GGCAAAATGATCGGGCAAGCAACTGCAGCAGACCAGGAGAAAAACCCTGAAGGTGATGGC
CTCCTTGAGTACAGCACCTTCAACTTCTGGAGAGCTCCCATTGCCAGCATCCACTCCTTC
GAACTGGACTTGCTCTAAGGCCAAGACTTCTCTCTCCCATCACCTTGCCCTCATTGTCTT
CCCTCTCAAGCCCCTTCCTTTCCACTCCTTTCCCATTTTAATCTTGTTCTCTCCCTACTG
TGTTGGTGGTGCTGATGAATCTGCCAGAGTTGAGTTCTATGTATTTATTTATCTATCTGT
CTACTCCATTTCTCTCAAAAGCCCTCAAGTCACAAAGTAAATGGTTCAAGCAATGGAGTA
CTGGGTCACAGGGATTCCTCCTTTCCCCCCCAAATATTAACTCCAGAAACTAGGCCTGAC
TGGGGACACCTGAGAGTAGTATAGTAGTGCAAAATGGAAGACTGATTTTTGACTCTATTA
TAATCAGCTTCAGAGATTCCTTAAACCTTCCTAATTTCCTGCTCCAGGGCAGTAAACACA
AATATTTCTTCAAGGGGTGATGAAAACCTCGGAAGTTTTAATTTGAGGTTATCTGCTACG
AAACAGTATTTCTAAAAGGCTAAAGTGATAAGTCTCTTGCTTTTTTTTGATCCTGCTCTT
ATATTCTTTTTTTTCCTCAGAGAAATCAGGAGGGTAGTTAGAGGTATAAAACAGGAGGAA
ATATTATGGAAAATGAAAATAGGGAAAATAATTGAATCATTTTAGAAGTAGCTAATTTCT
TTTCTCAAAAGAGTGTCCCTTCTTCACACCTACTCACTTTACAACTTTGCTCCTAACTGT
GGGTTGAAAACTCTAGCTAAAGAAAGTTATCAAATCTTAACATGCATTCCTACTATTATG
ATAGTTTTTAAGGTTTCAATTCAATCTTCTGAACGGCATAAGTCCTATTTTAGCCTTACC
TCCTGCATTTGCAATACGTAATACTGATCAGTGGGCACAGTTCTTCAGCTACATTGAGAC
CCTGAAATGAACAATTATATTCTGACTCGACATCTTGTCCCCAATCCTTCCAAAAATATT
GATGGTGATTTGTGCTACCATTTACTCGTTTATTTAATAAAGACATTCAATCCCAGGAAA
AAAAAAAAAAAAAAAAAAAA

Protein Sequence

>10962 : length: 90
MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKN
PEGDGLLEYSTFNFWRAPIASIHSFELDLL