ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10892

Name

MALT1

Synonym

IMD12|MLT|MLT1;MALT1 paracaspase;MALT1;MALT1 paracaspase

Definition

MALT lymphoma-associated translocation|MALT1 protease|caspase-like protein|mucosa associated lymphoid tissue lymphoma translocation gene 1|mucosa-associated lymphoid tissue lymphoma translocation protein 1|paracaspase

Position

18q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

TCR signaling in naive CD4+ T cells;PID Curated;200022

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

TCR signaling in naive CD8+ T cells;PID Curated;200062

Pathway

Canonical NF-kappaB pathway;PID Curated;200026

Disease

Sicca syndrome;FunDO

Disease

Embryoma;FunDO

Disease

Stomach cancer;FunDO

Disease

MALT lymphoma;OMIM

External Links

Links to cell senescence gene database

10892

Links to epithelial mesenchymal transition gene database

10892

Links to ovarian cancer gene database

10892

Links to endometrial cancer gene database

10892

Links to iHOP

10892

Sequence Information

Nucleotide Sequence

>10892 : length: 5046
CGAGGCTCCGTGCCCCGCCCCCCGGGTGCCCCGCCCCTTTGCGCGGCTGGCGCGGCCAGC
AGGCCAGGCTCCCCTCGGCAAACCTGTCTAATTGGGGCGGGGAGCGGAGCTTCCTCCTCT
GAGGGCCGTGCCGCGCTGCCAGATTTGTTCTTCCGCCCCTGCCTCCGCGGCTCGGAGGCG
AGCGGAAGGTGCCCCGGGGCCGAGGCCCGTGACGGGGCGGGCGGGAGCCCCGGCAGTCCG
GGGTCGCCGGCGAGGGCCATGTCGCTGTTGGGGGACCCGCTACAGGCCCTGCCGCCCTCG
GCCGCCCCCACGGGGCCGCTGCTCGCCCCTCCGGCCGGCGCGACCCTCAACCGCCTGCGG
GAGCCGCTGCTGCGGAGGCTCAGCGAGCTCCTGGATCAGGCGCCCGAGGGCCGGGGCTGG
AGGAGACTGGCGGAGCTGGCGGGGAGTCGCGGGCGCCTCCGCCTCAGTTGCCTAGACCTG
GAGCAGTGTTCTCTTAAGGTACTGGAGCCTGAAGGAAGCCCCAGCCTGTGTCTGCTGAAG
TTAATGGGTGAAAAAGGTTGCACAGTCACAGAATTGAGTGATTTCCTGCAGGCTATGGAA
CACACTGAAGTTCTTCAGCTTCTCAGCCCCCCAGGAATAAAGATTACTGTAAACCCAGAG
TCAAAGGCAGTCTTGGCTGGACAGTTTGTGAAACTGTGTTGCCGGGCAACTGGACATCCT
TTTGTTCAATATCAGTGGTTCAAAATGAATAAAGAGATTCCAAATGGAAATACATCAGAG
CTTATTTTTAATGCAGTGCATGTAAAAGATGCAGGCTTTTATGTCTGTCGAGTTAATAAC
AATTTCACCTTTGAATTCAGCCAGTGGTCACAGCTGGATGTTTGCGACATCCCAGAGAGC
TTCCAGAGAAGTGTTGATGGCGTCTCTGAATCCAAGTTGCAAATCTGTGTTGAACCAACT
TCCCAAAAGCTGATGCCAGGCAGCACATTGGTTTTACAGTGTGTTGCTGTTGGAAGCCCT
ATTCCTCACTACCAGTGGTTCAAAAATGAATTACCATTAACACATGAGACCAAAAAGCTA
TACATGGTGCCTTATGTGGATTTGGAACACCAAGGAACCTACTGGTGTCATGTATATAAT
GATCGAGACAGTCAAGATAGCAAGAAGGTAGAAATCATCATAGGAAGAACAGATGAGGCA
GTGGAGTGCACTGAAGATGAATTAAATAATCTTGGTCATCCTGATAATAAAGAGCAAACA
ACTGACCAGCCTTTGGCGAAGGACAAGGTTGCCCTTTTGATAGGAAATATGAATTACCGG
GAGCACCCCAAGCTCAAAGCTCCTTTGGTGGATGTGTACGAATTGACTAACTTACTGAGA
CAGCTGGACTTCAAAGTGGTTTCACTGTTGGATCTTACTGAATATGAGATGCGTAATGCT
GTGGATGAGTTTTTACTCCTTTTAGACAAGGGAGTATATGGGTTATTATATTATGCAGGA
CATGGTTATGAAAATTTTGGGAACAGCTTCATGGTCCCCGTTGATGCTCCAAATCCATAT
AGGTCTGAAAATTGTCTGTGTGTACAAAATATACTGAAATTGATGCAAGAAAAAGAAACT
GGACTTAATGTGTTCTTATTGGATATGTGTAGGAAAAGAAATGACTACGATGATACCATT
CCAATCTTGGATGCACTAAAAGTCACCGCCAATATTGTGTTTGGATATGCCACGTGTCAA
GGAGCAGAAGCTTTTGAAATCCAGCATTCTGGATTGGCAAATGGAATCTTTATGAAATTT
TTAAAAGACAGATTATTAGAAGATAAGAAAATCACTGTGTTACTGGATGAAGTTGCAGAA
GATATGGGTAAGTGTCACCTTACCAAAGGCAAACAGGCTCTAGAGATTCGAAGTAGTTTA
TCTGAGAAGAGAGCACTTACTGATCCAATACAGGGAACAGAATATTCTGCTGAATCTCTT
GTGCGGAATCTACAGTGGGCCAAGGCTCATGAACTTCCAGAAAGTATGTGTCTTAAGTTT
GACTGTGGTGTTCAGATTCAATTAGGATTTGCAGCTGAGTTTTCCAATGTCATGATCATC
TATACAAGTATAGTTTACAAACCACCGGAGATAATAATGTGTGATGCCTACGTTACTGAT
TTTCCACTTGATCTAGATATTGATCCAAAAGATGCAAATAAAGGCACACCTGAAGAAACT
GGCAGCTACTTGGTATCAAAGGATCTTCCCAAGCATTGCCTCTATACCAGACTCAGTTCA
CTGCAAAAATTAAAGGAACATCTAGTCTTCACAGTATGTTTATCATATCAGTACTCAGGA
TTGGAAGATACTGTAGAGGACAAGCAGGAAGTGAATGTTGGGAAACCTCTCATTGCTAAA
TTAGACATGCATCGAGGTTTGGGAAGGAAGACTTGCTTTCAAACTTGTCTTATGTCTAAT
GGTCCTTACCAGAGTTCTGCAGCCACCTCAGGAGGAGCAGGGCATTATCACTCATTGCAA
GACCCATTCCATGGTGTTTACCATTCACATCCTGGTAATCCAAGTAATGTTACACCAGCA
GATAGCTGTCATTGCAGCCGGACTCCAGATGCATTTATTTCAAGTTTCGCTCACCATGCT
TCATGTCATTTTAGTAGAAGTAATGTGCCAGTAGAGACAACTGATGAAATACCATTTAGT
TTCTCTGACAGGCTCAGAATTTCTGAAAAATGACCTCCTTGTTTTTGAAAGTTAGCATAA
TTTTAGATGCCTGTGAAATAGTACTGCACTTACATAAAGTGAGACATTGTGAAAAGGCAA
ATTTGTATATGTAGAGAAAGAATAGTAGTAACTGTTTCATAGCAAACTTCAGGACTTTGA
GATGTTGAAATTACATTATTTAATTACAGACTTCCTCTTTCTAAGATTTTGTGAATTGGT
TGAATAGTTCTATACAAATGAAGTATGGAGGTGTGTATGTTTATATGTATATAACAAAAT
ATTTTCATTGTGACCACTCTGAAGTAAGAGCAATGGGAATGGCATTATTGTAGAATAAGT
CATTGTATTTTTAACACCAGAAAGAACCTTGCCGATCACCAGGCATAACCTAATTTTATC
CATGGAAGAAACACAGAAAGGCATCTAAGTTAGAGCTGGCACCAGAACTGAGACCTCCAG
AAATCTATTCCAGTATTTTTTCCACTACACAACTGCCTTCCTGACAGGTTCTGAGATAAG
TGTTATGTTTGTAGATAGAGTGAAATATATTTATATATATATAAATATATACAGATACAT
ATCTGTGTATTATCTCAAGGAATGTACAAACTTTAGTTTTTGATTATAAGGACTTCACTG
CAAGTTTTAGTTAAGAGGTTTGTATATAAATCTGTTATAGAACAGGCTGAAATTTCTTGT
TCATAAGATTATGAAACCACATGAGAAGTGATAAAATGTTTGTTAAAGCTAGATAGAGGT
TAAGAATCAAGATATAATGGATAATTTTCATAGCTGCCTATCAGAATTTCCCAAATATTT
AGCATCTTCCTTGATAATATGTATTTTCTTCTTGAATTTCACTGGCCTAATGAGATAATA
CTCTTATCTTTGGCTCTACCTAAAAGTTGGTTAAAAATGCAATTGGCATTAACAAGGAAA
AATACTGAATTAGTAATTTTAAAAGTCTCACAAAGAAAATCCCAGGCCTAGATGGCTGCA
TTGTTGAATTCTGCCAAACATTAAAATTAGCACTAATTTTTTGCACACTGTTTCTAAAAG
TAGGAGAGGAAAGAACACTTCCCAACTTACTCTAGGTCAGTATTACCCTGATACTAGACT
AGACATCACAAGAAAACTATAAGCCAATATTCCTTATTAATACAAACACAAAAATCATTA
ACAAAAATATTAGCAAACTGAATCCAGCAACCTATAAAAAGGATTCTATATCATGACCAA
GTGGAATTTATCCCAGGAATTCAAGGTTGGTTCAACATCTAAAAATCAAATAAGCTAATA
TACAGTCAGTTCTCATTATTCACAGTAATTATGTTCTACAGAATATTCTCCCATAAACAC
TGAATTAAATATGGAACAACTGCTTTTAGGAGAAAGTGTATTTGTGTATATGTGTGTATA
CATATGTTTATCTCACACACATTATGAGCTTGAATTCTTAATTCATCCTAGCAAATTCTA
CCTTATTTTACAGAAGTGAAAGTGAGGTATCAGAAGTGTTAAGTGACATGCCTGAGGCAC
CCCCCTAACAGGTGTCAGAGCTGAAATTCAAACCCCATCCAGCTGGCCCCGGAGCCAGAG
CTTCTTGTACTACACAGAATTGCCCCTGCCATTTCCACCCTCCAGTCATTTCTCTATGAG
ACTGAAGCAGGAAGGCAGAGCATCATCTTGTTCAGCCTCAGCTGGGAACATGTGTACTGG
GTGACTCAAATTTTTCACCCATTTACACATATCCACAAATGACTGCAAAAGTGCCACGGA
TATCAATTTGAGGGTTATAAATTTTAGCAAGTTGGTAAATTCACAAATACATAACCTTGA
ATAATGAGGATCAACTGTACCATATTTAATAAAGCACAAAACCCACACAGATTGTCTTAT
TACAGCATTTGATAAAATCCAAAACTCTTTCATAAAAACACTCAACAAACTTAGGAATAA
AAGGAATCTTCCTAGATATGATAAATATAACATCTATGAAAAGCCCACACCTAACATTAT
ACTTCATGGTGATAGACTGAAGGCTGAATGTTTTCCCCTTAAGATTGGGAAGAAGGACAA
GGATGTTCACTCGGCACTACTTCTATTCAGCATTGTACTTGAAGTTCTAGCCACAGCAGT
TAGGTTAGGAATTCAAGGTTTGTTCAACATCTAAAAATCAAATAAGCTAATAAAGAAAAG
AGGTTTATACTGCAAAAGAAGTGAAACTATATGTATTCACAGTTGATACATAGTTGTATA
TAGAAAATGCTAAAGAATCCATAAAAAGTAATAAATGAGTTCAACAGGTTAAAAAAAAAA
AAAAAA

Protein Sequence

>10892 : length: 824
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAV
HVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMP
GSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD
SKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLK
APLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDAL
KVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCH
LTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQI
QLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVS
KDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRG
LGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCS
RTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK