ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10879

Name

SMR3B

Synonym

P-B|PBII|PRL3|PROL3|SMR1B;submaxillary gland androgen regulated protein 3B;SMR3B;submaxillary gland androgen regulated protein 3B

Definition

proline rich 3|proline-rich peptide P-B|proline-rich protein 3|salivary proline-rich protein|submaxillary gland androgen regulated protein 3 homolog B|submaxillary gland androgen-regulated protein 3B

Position

4q13.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10879

Links to epithelial mesenchymal transition gene database

10879

Links to ovarian cancer gene database

10879

Links to endometrial cancer gene database

10879

Links to iHOP

10879

Sequence Information

Nucleotide Sequence

>10879 : length: 798
GCCAACAGAAATCCATTACAATATATAAGAGCTAAGATTTCTTGTCCCTTTTCACCTTTA
TTTGCCGTCTTTCAACTGGCAAGAGTCATTTTGACCAGCAGATTAATCAACTGTAAGACA
GATCCTCACACAAAGAGGCAACTGAAAGGATGAAATCACTGACTTGGATCTTGGGCCTTT
GGGCTCTTGCAGCGTGTTTCACACCTGGTGAGAGTCAAAGAGGCCCCAGGGGACCATATC
CACCTGGACCGCTGGCTCCTCCTCAACCTTTTGGCCCAGGATTTGTTCCACCACCTCCTC
CTCCACCCTATGGTCCAGGGAGAATCCCACCTCCTCCTCCCGCACCCTATGGTCCAGGGA
TATTTCCACCACCCCCTCCTCAACCCTAAGGTCCACCACTCCATCCTGATGCCCCAGGTT
ATCCACAGCCTCCTTCCCGACCAAGACCCTATCCACCTGGACCTCCATTTTTCCCTGTAA
ATTCTCCAACTGATCCTACCCTCCCTACTCCTGCACCCCAAATATGAACAACTGCAGCAG
GTGCCACCACCACCACAAAAGACACCACTACCCTTGTAACTACTGCTTCTACTACCCAAA
ATATGAATTCCAACACTGCTTCCAAGAGACATTTACATAAAATTGCTTCCATTTTTGGAT
GAGAATGAAAAATTCCAAAAGTGCTGAGCTTTGGGGAGAAATAATCTTAGAAAGAAATTG
TAGAAAAAACCCATGCAGACATAACATTTATACCAATGAGGCAAAAATAAAGAATTGAGC
ACCAAAAAAAAAAAAAAA

Protein Sequence

>10879 : length: 79
MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIP
PPPPAPYGPGIFPPPPPQP