ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10863

Name

ADAM28

Synonym

ADAM 28|MDC-L|MDCL|eMDC II|eMDCII;ADAM metallopeptidase domain 28;ADAM28;ADAM metallopeptidase domain 28

Definition

disintegrin and metalloproteinase domain-containing protein 28|epididymal metalloproteinase-like, disintegrin-like, and cysteine-rich protein II|epididymial metalloproteinase-like, disintegrin-like, and cysteine-rich protein II|metalloproteinase-like, dis

Position

8p21.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10863

Links to epithelial mesenchymal transition gene database

10863

Links to ovarian cancer gene database

10863

Links to endometrial cancer gene database

10863

Links to iHOP

10863

Sequence Information

Nucleotide Sequence

>10863 : length: 7893
ATTCTGTCCTATCCACAGATCTAAGGTTCCTAATGCTGCTGCATGCCTCATATCTCACTC
CTGCCCTGTTAGGGTTCTTGGGTTCTGCCATATCACAGTTGTTTTACAAACATAGACTGA
AGAAGCTAGTGACATCTTTGTTTGCCACACAACAAATACATGATTTCCATTGGCATAGAC
TCTTCTATAGTCTCTCAGGCACACCTTATGACTAATAAGAACACTGTCTTCTAGATATAA
GCCAAGTTTTAGGAGTTATCTTTGTAGTTTCTGTGTTGAGACTATGGGTCTTCCCTGTGC
AAAGACTTGATTAGCAAATACTATTTGAAACGATCCCAAATTCATAGTGCAGTTGACCAC
CCTTCTGATCAAGGGGATCTCTGTATATCCCATGAAAGCTTCATAGGTCTCACCCTAGAT
TAAGTGCTTCACTTCTCAAGACAGTGAACAGATGGAAGACTTTTGTAGTTATCATTATAC
AACTGTGCCCTGTGTTGTTTTATTATACAACCAGAGAACTGAGGCACTGGCTTTACCTGT
CAGCTACGCCAGGGTTGTGACGTCATCTTTCTGACTTGATCACACATGCCACATTGCTTA
ATATTTCAGCTAGACTGAAATAATCCTGTGTAAAAATTTTTGGGGGCTGGGAGTAAAGAA
CAAGGTGGAACTTTGAATATTTTATTCATAATCATATTCACGATTGTATTTATATGAATG
ACATAAGGACTAAATAAGTATGTGTTAAATAAATGACCAAATGAGTAAGTAAACTAATGG
ACAAATGAATAAATGTTTATGACTGGAGCATATTACCCATAAACCTCCATAGATGCATAT
TTAACCTATACTCTGTGAAAGTCCCTGATGCTGGGAACTTAAATTCTAAAGACAGTAACT
ATTCTTCAGAGAATTCAGCATCCAGATTGTACATGTTCTTAGAGGCCCAAACCATCTTGG
TATTGGCCCATGTCGTAAAAGAAAATATCTTACAGCACAATTCCTCCCTCAGATTGAGAA
TTCTTTCAGGCCCATTAGCTGATTTAGCAGGGTTTCTAGAGCTCACGGATTTACTGTAAG
TTTTGAACAACTGTTGTATTACTAGAATTAAGAACCTCTCTGTGTATTCTACGGCTGCCC
TTGATATTTCCTGTGTGCCCATTGACATCCCCTAGACCTTACAGATTTGCTCCATCCCAG
AAACATCCAGGACTGTGGCTTTCCCAATCCACCCACTAAATCAGACCCATGTCATTATTT
TAGAGGAAATTTGGATCTATATGTTTCTGTGGTCAGCTAGTCTTACTCAGTAAAACCAAA
ATCATTTCCTTATAGTGAGTGCTCTCCAAATCAAGGTGCATCTTACTTCTCTTGATGCAT
ACTTCAGAACCTACAGAGTACACAACTAGAACACACTTCTTATCCTCAAACCTTGCTCTC
CACCAGGGAACTCTCTTTCAAAAGTATTATTATTACATTACCCAGTGTACTCTCTTTCAT
AGAGGCCCTGGCTTTCTTCCTTCATCTTTCCTTCCATCCATAATCTTTATGCCAGTGTTA
ACCAAAACTCCACTCCAAAAGCATTTATTCTTTTCTAAAACAACCTTCAGCTAAAGTTTT
AGTAACTAAATCTACTAAAAAGCCATTGCTGAACAGGAAGCAGATATCTGGAAGGCCATT
TCTGGTAGAAGACCATATTTGGTATCATTCTCATGGCTTCATTCTAGCTAGGCTTTCTTA
ATCCTGAACAGTAAGAGGTTATGACTATTCTGCATAACTTTTATTTTCAATGCCCTTTCT
CTTTCCAGTTCCTGTCATCCATGAAAATAAGCTGAGTCCATCAACCTCTACTTATCTAGG
CCCACATTTGGGGGAAATTTATAGCCTGGGATTACTGACAGCAGAGCAGACCTCAACAAC
TGAGGATTTAAGCAAAGAACAATTTGAAACTGAATTAAAGTATAAAATGACAATTAATGG
AAAAATTGCAGTGCTTTATTTGAAAAAAAACAAGAACCTCCTTGCACCAGGCTACACGGA
AACATATTATAATTCCACTGGAAAGGAGATCACCACAAGCCCACAAATTATGGATGATTG
TTATTATCAAGGACATATTCTTAATGAAAAGGTTTCTGACGCTAGCATCAGCACATGTAG
GGGTCTAAGGGGCTACTTCAGTCAGGGGGATCAAAGATACTTTATTGAACCTTTAAGCCC
CATACATCGGGATGGACAGGAGCATGCACTCTTCAAGTATAACCCTGATGAAAAGAATTA
TGACAGCACCTGTGGGATGGATGGTGTGTTGTGGGCCCACGATTTGCAGCAGAACATTGC
CCTACCTGCCACCAAACTAGTAAAATTGAAAGACAGGAAGGTTCAGGAACATGAGAAATA
CATAGAATATTATTTGGTCCTGGATAATGGTGAGTTTAAAAGGTACAATGAGAATCAAGA
TGAGATCAGAAAGAGGGTATTTGAGATGGCTAATTATGTCAACATGCTTTATAAAAAGCT
CAATACTCATGTGGCCTTAGTTGGTATGGAAATCTGGACTGACAAGGATAAGATAAAGAT
AACCCCAAATGCAAGCTTCACCTTGGAGAATTTTTCTAAATGGAGGGGGAGTGTTCTCTC
AAGAAGAAAGCGTCATGATATTGCTCAGTTAATCACAGCAACAGAACTTGCTGGAACGAC
TGTGGGTCTTGCATTTATGTCTACAATGTGTTCTCCTTATTCTGTTGGCGTTGTTCAGGA
CCACAGCGATAATCTTCTTAGAGTTGCAGGGACAATGGCACATGAAATGGGCCACAACTT
TGGAATGTTTCATGACGACTATTCTTGCAAGTGTCCTTCTACAATATGTGTGATGGACAA
AGCACTGAGCTTCTATATACCCACAGACTTCAGTTCCTGCAGCCGTCTCAGCTATGACAA
GTTTTTTGAAGATAAATTATCAAATTGCCTCTTTAATGCTCCATTGCCTACAGATATCAT
ATCCACTCCAATTTGTGGGAACCAGTTGGTGGAAATGGGAGAGGACTGTGATTGTGGGAC
ATCTGAGGAATGTACCAATATTTGCTGTGATGCTAAGACATGTAAAATCAAAGCAACTTT
TCAATGTGCATTAGGAGAATGTTGTGAAAAATGCCAATTTAAAAAGGCTGGGATGGTGTG
CAGACCAGCAAAAGATGAGTGCGACCTGCCTGAAATGTGTAATGGTAAATCTGGTAATTG
TCCTGATGATAGATTCCAAGTCAATGGCTTCCCTTGCCATCACGGGAAGGGCCACTGCTT
GATGGGGACATGCCCCACACTGCAGGAGCAGTGCACAGAGCTGTGGGGACCAGGAACTGA
GGTTGCAGATAAGTCATGTTACAACAGGAATGAAGGTGGGTCAAAGTACGGGTACTGTCG
CAGAGTGGATGACACACTCATTCCCTGCAAAGCAAATGATACCATGTGTGGGAAGTTGTT
CTGTCAAGGTGGGTCGGATAATTTGCCCTGGAAAGGACGGATAGTGACTTTCCTGACATG
TAAAACATTTGATCCTGAAGACACAAGTCAAGAAATAGGCATGGTGGCCAATGGAACTAA
GTGTGGCGATAACAAGGTTTGCATTAATGCAGAATGTGTGGATATTGAGAAAGCCTACAA
ATCAACCAATTGCTCATCTAAGTGCAAAGGACATGCTGTGTGTGACCATGAGCTCCAGTG
TCAATGTGAGGAAGGATGGATCCCTCCCGACTGCGATGACTCCTCAGTGGTCTTCCACTT
CTCCATTGTGGTTGGGGTGCTGTTCCCAATGGCGGTCATTTTTGTGGTGGTTGCTATGGT
AATCCGGCACCAGAGCTCCAGAGAAAAGCAGAAGAAAGATCAGAGGCCACTATCTACCAC
TGGCACCAGGCCACACAAACAGAAGAGGAAACCCCAGATGGTAAAGGCTGTTCAACCCCA
AGAGATGAGTCAGATGAAGCCCCATGTGTATGATCTGCCAGTAGAAGGCAATGAGCCCCC
AGCCTCTTTTCATAAAGACACAAACGCACTTCCCCCTACTGTTTTCAAGGATAATCCAGT
GTCTACACCTAAGGACTCAAATCCAAAAGCATGAAGCAACAGCTAAGCAAGAACTAATGG
CTAAATTATCAACTTGGAAAACTGGAAAATCTGGATGGCAGAGAAATATACTATCTATCT
CACCAGTATTTGCTCTCGACTCAAGAAGGTTAACATTTTCTGATTCATGTTAGACTTTGA
AGAGACTAAAGAAAATTTTCAAGAGGAACATATGCCTGAGAACCTTTGCATGAATTTAAA
ATTTCAATTATCCATTCTTATAAGAAGGAAGATGATTGTAAAGAAATATCTCCGAAGTTA
AAATCTGTAATAGGAATTGATTCATTCTCTAATGAAAACAAAACATAAAAACATCACACT
AATCTTGGAGGAATAAGAAAAATTGTACATCCATTAAATGTACAATTGATTGCAACATCT
TGATTGTTTTAACCATTAACTTGTCAAATTACAATCACAGTTAAGAAAATGATGTAAAAT
TCTGTTTTGTGGATCTCTTTCCTAGATTAGCTTCTGAAATCATTATTAGCTATATCATTT
GAGGTTTTCTACAATTTGGTATAACTAAGAATTTAAAAATGTTTTATCATATATATTTGT
ATAATTAATTACTGGCATGGTTAAAGTGGTTTTCACTTTTTAAATGGAGAAAATTTCAGT
TAAATTAATAGGATAAACCAGGTTGCGAACTGGTGACCTGTAGGCCATGTTTGCACTGCA
AATATATTTGGTCTGAATGATATTGATATTGGACACATAGTACTTTTACATGTTTTGAAT
GTATTGCTAATATTTAAAAATTGAGAGATCTTGCATAAACAATAGATTCCCAGCTTTGTC
AGATGTAATCTAAAAGTAATCCGATGCTTTGTCAACAACAGACTTACATTGCCCATAGCA
ACCGTCAGCTTAGTTGATGGGTAATGTAGCAAACACTATTGGTTTCCTACCAAATAATCC
CCTTTTTCCTGGCTTTTAGAACAATAATTTTGTTCACCTGCCCACTTCTAGGAAAGAATA
TCCTATCTAATCTATCTATCTCAGGGATAAATCCCTATCCTTTTAAGTAAGTCAAGTCAA
TTAAAATAACCTCATTTTTCCTTGCTAGTGGTCGACTTGGAGATGATTTTATAATCCTCC
CCCTCCCTTTTTTTTTTTGCTAGTAAGACGACAGAGGAATTATGTTACAACACTTCTGGA
AAATTTTTCCTCGTCTCTTTTTCTGGATATGGGCATCTGAATACTCTAGCTGGTACTGCT
GCGCTCCACACGGTGATTATGAAGGCTGAAAAAGATAGATAGAGCAGAAAGATGAAAAGA
ATAAAACCTGGCCTTTCAATGATGTCATGGAATTGGTAGATCAGTGACTGCTGGAGTTAC
CTCACACTTTCTTGGTACTCCTTATTATATGAGCCATACATTTTCCTTGTTGTTTAAGCC
ATTTTGAATTGGATTTTCTCTCACTTTCAACAGAGATCATCCTAACTAGTAAAGTAGCTG
TTTCCATAATCAGGGAACATGCTTTAGTTCATCATCACAGCTACAGTTTTTCTTGTATTT
GTCTGCTTCACCCATTTCTATCAATCACTTACCTGGTCCCCACAGGCCTGTCGCTTCATG
AGGAACTTTATGGTTCATTTACCCTTGCAGTATGAGGTTCTAGATAAGCCCACTCTGGCC
TCAAAAGTGAAGCTCAGTCCTCAGGAAATCCAGAGTCCACTGATCAAATCACTGTCAAGG
ATACAGGCTTTTTCTCCATGTGGCATTTGCAGAAGAACAACTTTAAAAGTAGAGCTTTAT
CTGCCCTGTGAGGTTTCAGAAGACCCTCCCCTGACCCAGAAATAAATCCCTATTTCCTGG
AAAGCCATTATGTACTCGTGACCAACTTGTGAACTTTTCTGTGTTGTTGTTGTTGTTTTT
TAAATATCTGTCCCCAGTAATAGATTCACCTAATCCTTTTTTATACTGATGGAATGGAAA
TCTTAAATCTATGAATCCTCAACTAGCCATGTACCATAACCCAAGCAAAAACTAAACCAT
ACACTCTCAAAAGCAGTGGCATGTGAACATGCCTGCAAGTTCCTAAATGATGTCACTAGG
TCCCTGATGCAGATGCATCATACGTCCTATTTGAAGAGAAGAAATGCAGTACAATGACAG
GAAAACCATTATTTTATCATAGAACTGCGAACCCAAGTCCTACAATGTTTCCCTTTCAGC
TCAACTGCAGAATAGTTTAGAACAGACTTTTTGATTTCACAATACTGTTTCCACACTTAC
TTATATCCGTAACTTTCTAACTTTAAGGGAATTCCGCTTATTTGACATTTAACTACCTCA
GATATGCCACCAAACCTGTTTTCATCATTAGTTATTTTTACCTTGTCTACTTTAAAACAG
TGAAATTATTAGGTTAAATTATGTTTTTATCCAGTTACTCTAAGATACCTTAGTGTTTGT
CTACTTATTACAACTCACCAAATTACTGGTTTTATATGGCCTTTGGGAAGGCTTTTAGCT
TTTTATAAAATAATGAAGTATGCATGAAAAGAAAGCAAATTTTAGTTGGTTGCAGTCAGA
GAATATGGAAAGGGTTATTATTATAATTAGGATTTTATTATTCACATTGGAAATCACTGC
TATGTGTTAAGGAATTGAAGGTGGCCTCTGGCTAGCAGCCATTAAGAAAATGAGCCCCTG
AGTTCAACGACCCTCAAATGAAGTGAAGTCTACCAATAACCACTGAATAAGCTTGGAATT
TTAGATTCCTTCCCAGCTGAATCTTGACTTCAGCCTTGTGAGACACCCTGAAGTAGAGGA
TGCAGCTAAATTTTGTCCAGATTACACACCCACAGAAACTGTATGATAATTAATATGTGT
TGTTTAAAGTTGTTATGGTTTGGAGATATTTGTTATGCAGCAATAGATAGCTGATACAAG
GAAGTAGAGAACAAACATTTTCTATTAGTCTGTTTTCACATGGCTATAAAGAATACCACC
TGAGACTGGGTAATTTATAAAGAAAGGAGGATTAATTGACTCAGATTTCCACATGGCCTA
GGAGGCCTCAGGAAACTTACAATCATGATGAAAGAGGAAGCAGAAACATCTCATATGATG
GAAGATGTGTATGAAGGAGGAACTGTCAAACACTTATAAAACCATCAGATCTCTTGAGAG
CTTACTATCTCGACAAAAGCATGGGGGAAACCACCCCCATGATCCAATCACCTCCCACCT
GGTCCCTCCCTCAACATGTGGAGATTATAGCAATTAAAAAAATGAGATTTGGGGGGATGG
ACACAGAGCCAAACCATATAATGTTTTAAATGCTCCAGATAGGTTTAGGTAAAATTAACT
ATATTTAATAGGCTTTCATCACTGCAAAACTTTTTTTCCTTTCTTTGTGTCTCTAGTCTC
TTCCATTTGTTCTCCCTTCTTTACTAGCACCGAGGATTTGCTTGAAATCTCTGATAGCCA
GTATTCTCATTTATCATATTCTTTCTCACTTTGTGTTTCCTTGGTAATTTTGGATAACTC
CTTAAATTTATCTTCCAAATTACTGGTTTTTATATTCTGTACTGTCAGTCCTCCTGTTCA
CTAATTTCAAAATTTATAGTTGTTTCTCTTGTTTACTTATATAGTTGTTTCTCTTGTTTA
CTTAATAACATTCTCTTCTTTCCTATCAGTTTAATTTTATAAAGGCTAACCAATTAACTG
TTTTTAACTTATATTTCCAGATATTTTAAAAATTAAAGCAAAATGTGTATAAACTTTATT
ACTGCTTCCCACAGTAAATATTTTTCAGAAGTA

Protein Sequence

>10863 : length: 775
MLQGLLPVSLLLSVAVSAIKELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYK
MTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYYQGHILNEKVSDAS
ISTCRGLRGYFSQGDQRYFIEPLSPIHRDGQEHALFKYNPDEKNYDSTCGMDGVLWAHDL
QQNIALPATKLVKLKDRKVQEHEKYIEYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNM
LYKKLNTHVALVGMEIWTDKDKIKITPNASFTLENFSKWRGSVLSRRKRHDIAQLITATE
LAGTTVGLAFMSTMCSPYSVGVVQDHSDNLLRVAGTMAHEMGHNFGMFHDDYSCKCPSTI
CVMDKALSFYIPTDFSSCSRLSYDKFFEDKLSNCLFNAPLPTDIISTPICGNQLVEMGED
CDCGTSEECTNICCDAKTCKIKATFQCALGECCEKCQFKKAGMVCRPAKDECDLPEMCNG
KSGNCPDDRFQVNGFPCHHGKGHCLMGTCPTLQEQCTELWGPGTEVADKSCYNRNEGGSK
YGYCRRVDDTLIPCKANDTMCGKLFCQGGSDNLPWKGRIVTFLTCKTFDPEDTSQEIGMV
ANGTKCGDNKVCINAECVDIEKAYKSTNCSSKCKGHAVCDHELQCQCEEGWIPPDCDDSS
VVFHFSIVVGVLFPMAVIFVVVAMVIRHQSSREKQKKDQRPLSTTGTRPHKQKRKPQMVK
AVQPQEMSQMKPHVYDLPVEGNEPPASFHKDTNALPPTVFKDNPVSTPKDSNPKA