ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10848

Name

PPP1R13L

Synonym

IASPP|NKIP1|RAI|RAI4;protein phosphatase 1, regulatory subunit 13 like;PPP1R13L;protein phosphatase 1, regulatory subunit 13 like

Definition

NFkB interacting protein 1|NFkB-interacting protein 1|PPP1R13B-like protein|inhibitor of ASPP protein|inhibitor of apoptosis stimulating protein of p53|protein iASPP|protein phosphatase 1, regulatory (inhibitor) subunit 13 like|relA-associated inhibitor|r

Position

19q13.32

Gene Type

protein-coding

Pathways and Diseases

Pathway

p53 pathway;PID Curated;200175

Disease

lung cancer;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

10848

Links to epithelial mesenchymal transition gene database

10848

Links to ovarian cancer gene database

10848

Links to endometrial cancer gene database

10848

Links to iHOP

10848

Sequence Information

Nucleotide Sequence

>10848 : length: 3122
CTTCCTAAGCCTTAAAGAGACAGGACGGTCGATTGGTCTGAAATTCTTGAAGAGACAGGC
GCCCGCTCCGGCCGGCACCATGGACAGCGAGGCATTCCAGAGCGCGCGGGACTTTCTGGA
CATGAACTTCCAGTCGCTGGCCATGAAACACATGGATCTGAAGCAGATGGAGCTGGACAC
GGCGGCGGCCAAGGTGGATGAACTGACCAAGCAGCTGGAGTCGCTGTGGTCAGACTCTCC
CGCGCCTCCTGGCCCGCAGGCCGGACCCCCTTCTAGGCCGCCCCGGTACAGCTCCAGCTC
GATCCCTGAGCCCTTCGGCAGCCGAGGGTCCCCCCGGAAGGCGGCCACCGACGGCGCAGA
CACCCCGTTCGGACGATCAGAGAGTGCCCCAACCCTACACCCCTACAGCCCGCTGTCCCC
CAAGGGACGGCCGTCGTCGCCGCGCACCCCGCTCTACCTGCAGCCGGACGCCTACGGCAG
CCTGGACCGCGCGACCTCGCCCCGGCCCCGCGCCTTCGATGGCGCAGGCAGCTCCCTCGG
CCGTGCGCCCTCCCCGCGGCCCGGGCCAGGCCCGCTCCGCCAGCAGGGTCCCCCCACGCC
TTTCGACTTCCTGGGCCGCGCAGGCTCCCCCCGCGGCAGCCCCCTGGCGGAGGGGCCCCA
GGCCTTCTTCCCCGAGCGTGGGCCGTCACCGCGCCCCCCTGCCACAGCCTACGACGCGCC
AGCGTCCGCCTTCGGGAGCTCCCTGCTAGGCTCCGGCGGCAGCGCATTCGCCCCGCCTCT
GCGCGCGCAAGACGACCTGACGCTGCGCCGGCGGCCTCCGAAAGCCTGGAACGAGTCTGA
CCTGGACGTGGCGTACGAGAAGAAGCCTTCGCAGACAGCGAGCTATGAACGCCTGGACGT
CTTCGCAAGGCCTGCCTCGCCGAGCCTGCAGCTGTTGCCTTGGAGGGAGAGCAGCCTGGA
TGGACTGGGGGGCACCGGCAAGGACAACCTCACTAGCGCCACCCTGCCGCGCAATTACAA
GGTCTCTCCTCTGGCCAGCGACCGGCGTTCAGACGCGGGCAGCTACCGGCGCTCGCTGGG
CTCCGCGGGGCCGTCGGGCACTTTGCCTCGCAGCTGGCAGCCCGTCAGCCGCATCCCCAT
GCCCCCCTCCAGCCCCCAGCCCCGCGGGGCCCCGCGCCAGCGTCCCATCCCCCTCAGCAT
GATCTTCAAGCTGCAGAACGCCTTCTGGGAGCACGGGGCCAGCCGCGCCATGCTCCCTGG
GTCCCCCCTCTTCACCCGAGCACCCCCGCCTAAGCTGCAGCCCCAACCACAACCACAGCC
CCAGCCACAATCACAACCACAGCCCCAGCTGCCCCCACAGCCCCAGACCCAACCCCAAAC
CCCTACCCCAGCCCCCCAGCATCCCCAACAGACATGGCCCCCTGTGAACGAAGGACCCCC
CAAACCCCCCACCGAGCTGGAGCCTGAGCCGGAGATAGAGGGGCTGCTGACACCAGTGCT
GGAGGCTGGCGATGTGGATGAAGGCCCTGTAGCAAGGCCTCTCAGCCCCACGAGGCTGCA
GCCAGCACTGCCACCGGAGGCACAGTCGGTGCCCGAGCTGGAGGAGGTGGCACGGGTGTT
GGCGGAAATTCCCCGGCCCCTCAAACGCAGGGGCTCCATGGAGCAGGCCCCTGCTGTGGC
CCTGCCCCCTACCCACAAGAAACAGTACCAGCAGATCATCAGCCGCCTCTTCCATCGTCA
TGGGGGGCCAGGGCCCGGGGGGCCGGAGCCAGAGCTGTCCCCCATCACTGAGGGATCTGA
GGCCAGGGCAGGGCCCCCTGCTCCTGCCCCACCAGCTCCCATTCCACCCCCGGCCCCGTC
CCAGAGCAGCCCACCAGAGCAGCCGCAGAGCATGGAGATGCGCTCTGTGCTGCGGAAGGC
GGGCTCCCCGCGCAAGGCCCGCCGCGCGCGCCTCAACCCTCTGGTGCTCCTCCTGGACGC
GGCGCTGACCGGGGAGCTGGAGGTGGTGCAGCAGGCGGTGAAGGAGATGAACGACCCGAG
CCAGCCCAACGAGGAGGGCATCACTGCCTTGCACAACGCCATCTGCGGCGCCAACTACTC
TATCGTGGATTTCCTCATCACCGCGGGTGCCAATGTCAACTCCCCCGACAGCCACGGCTG
GACACCCTTGCACTGCGCGGCGTCGTGCAACGACACAGTCATCTGCATGGCGCTGGTGCA
GCACGGCGCTGCAATCTTCGCCACCACGCTCAGCGACGGCGCCACCGCCTTCGAGAAGTG
CGACCCTTACCGCGAGGGTTATGCTGACTGCGCCACCTACCTGGCAGACGTCGAGCAGAG
TATGGGGCTGATGAACAGCGGGGCAGTGTACGCTCTCTGGGACTACAGCGCCGAGTTCGG
GGACGAGCTGTCCTTCCGCGAGGGCGAGTCGGTCACCGTGCTGCGGAGGGACGGGCCGGA
GGAGACCGACTGGTGGTGGGCCGCGCTGCACGGCCAGGAGGGCTACGTGCCGCGGAACTA
CTTCGGGCTGTTCCCCAGGGTGAAGCCTCAAAGGAGTAAAGTCTAGCAGGATAGAAGGAG
GTTTCTGAGGCTGACAGAAACAAGCATTCCTGCCTTCCCTCCAGACCTCTCCCTCTGTTT
TTTGCTGCCTTTATCTGCACCCCTCACCCTGCTGGTGGTGGTCCTTGCCACCGGTTCTCT
GTTCTCCTGGAAGTCCAGGGAAGAAGGAGGGCCCCAGCCTTAAATTTAGTAATCTGCCTT
AGCCTTGGGAGGTCTGGGAAGGGCTGGAAATCACTGGGGACAGGAAACCACTTCCTTTTG
CCAAATCAGATCCCGTCCAAAGTGCCTCCCATGCCTACCACCATCATCACATCCCCCAGC
AAGCCAGCCACCTGCCCAGCCGGGCCTGGGATGGGCCACCACACCACTGGATATTCCTGG
GAGTCACTGCTGACACCATCTCTCCCAGCAGTCTTGGGGTCTGGGTGGGAAACATTGGTC
TCTACCAGGATCCCTGCCCCACCTCTCCCCAATTAAGTGCCTTCACACAGCACTGGTTTA
ATGTTTATAAACAAAATAGAGAAACTTTCCTTATAAATAAAAGTAGTTTGCACAGAAATT
GA

Protein Sequence

>10848 : length: 828
MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQ
AGPPSRPPRYSSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSPLSPKGRPSS
PRTPLYLQPDAYGSLDRATSPRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGR
AGSPRGSPLAEGPQAFFPERGPSPRPPATAYDAPASAFGSSLLGSGGSAFAPPLRAQDDL
TLRRRPPKAWNESDLDVAYEKKPSQTASYERLDVFARPASPSLQLLPWRESSLDGLGGTG
KDNLTSATLPRNYKVSPLASDRRSDAGSYRRSLGSAGPSGTLPRSWQPVSRIPMPPSSPQ
PRGAPRQRPIPLSMIFKLQNAFWEHGASRAMLPGSPLFTRAPPPKLQPQPQPQPQPQSQP
QPQLPPQPQTQPQTPTPAPQHPQQTWPPVNEGPPKPPTELEPEPEIEGLLTPVLEAGDVD
EGPVARPLSPTRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHK
KQYQQIISRLFHRHGGPGPGGPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPE
QPQSMEMRSVLRKAGSPRKARRARLNPLVLLLDAALTGELEVVQQAVKEMNDPSQPNEEG
ITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCAASCNDTVICMALVQHGAAIF
ATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYSAEFGDELSFR
EGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV