ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10795

Name

ZNF268

Synonym

HZF3;zinc finger protein 268;ZNF268;zinc finger protein 268

Definition

zinc finger protein 3|zinc finger protein HZF3

Position

12q24.33

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10795

Links to epithelial mesenchymal transition gene database

10795

Links to ovarian cancer gene database

10795

Links to endometrial cancer gene database

10795

Links to iHOP

10795

Sequence Information

Nucleotide Sequence

>10795 : length: 5862
CCGGCGCGGGAGTAACTCCTCGCAGAGGCCTCTGGGAGTTGTAGTTTTTTTGCCTTTGCC
TCTCCATGACGCAATTCCTGTGCGACATACGTAGCGGCCGCCATTGTTCCGCGCCGATGG
CGAGATCCTTGTTCCTCAGATAGCGTTCATCGCCCGTCGTGGTCAACGGGCCAGCCGAGT
CTGGAGTGGTTGCGAACCCTTCTGGCTGCAGATCTGGAGGTGGAGGCAGTACCCTGGACT
CTATTCTGCTGCCCCTTCAGGGTTTGGAGGAGCCGGAGCATCCCTCGCGTCCTGTCACTT
CCAGCGAGGCACACAAAACTGACCGTAGGGATGGCCACCAGGGTCCGGACAGCTTCTATT
TGGGTCCCACCTCTCCAAGAACGAAACAGTTCATGGGATAGGATCAGAAAGCTCCAAGGT
CAGGAATCCATCTTGGGCCAAGGGACTCCTGGTCTGCAACCTCTCCCTGGAACACCCAGG
CAGAAGCAGAAGAGTCGCAGAATAGAGAAAGTCCTAGAGTGGCTGTTTATTTCCCAAGAG
CAGCCAAAAATCACCAAGTCCTGGGGACCTTTGTCATTCATGGATGTGTTTGTGGATTTT
ACCTGGGAGGAGTGGCAGCTGCTAGACCCAGCACAGAAGTGCCTGTACAGGAGTGTGATG
TTGGAGAACTATAGCAACCTGGTGTCCCTAGGGTACCAACACACCAAACCTGATATCATC
TTCAAGTTGGAACAAGGAGAAGAGCTGTGTATGGTGCAGGCCCAAGTTCCAAATCAGACC
TGTCCAATTTTGAAGGCTGGAAAGTCCAAAGCCAAGGTGCTGGCAGGTTTGGTGTCTGGT
GAGGGCCTGCTCTGTGCTTCCAAGATGACGCCTTGTTGCTGCATCCTCTGGAGACACAGT
CTGGAAAATTGATGATCTTATGGATTGGCATCAGGAAAATAAAGACAAGCTGGGAAGTAC
GGCAAAAAGCTTTGAATGCACTACATTTGGAAAACTATGTCTTCTTAGTACAAAGTATCT
TTCAAGACAAAAACCTCATAAATGTGGCACGCATGGAAAGAGTTTGAAATATATAGATTT
CACTAGTGATTATGCTAGAAATAATCCTAATGGGTTTCAGGTACATGGAAAATCATTCTT
CCATTCTAAACATGAGCAAACTGTTATTGGAATAAAATACTGTGAAAGTATTGAATCTGG
AAAAACCGTCAATAAGAAATCGCAACTTATGTGCCAACAAATGTATATGGGCGAAAAACC
CTTTGGATGCAGCTGTTGTGAGAAAGCCTTCAGCAGCAAGTCATACCTTCTAGTGCATCA
GCAAACTCATGCCGAAGAGAAACCCTATGGTTGTAATGAATGTGGGAAAGACTTCAGTAG
TAAATCATACCTCATTGTACATCAGAGAATTCATACAGGAGAGAAACTACATGAATGCAG
TGAATGCAGGAAAACATTCAGTTTCCATTCACAGCTTGTTATACATCAGAGAATTCACAC
AGGTGAGAATCCCTATGAGTGCTGTGAATGTGGGAAAGTCTTCAGTAGGAAAGACCAGCT
TGTTTCACACCAGAAAACTCATTCAGGACAGAAACCATATGTGTGTAATGAATGTGGGAA
AGCTTTTGGTTTAAAATCACAGCTCATTATACATGAAAGAATTCATACAGGAGAGAAACC
ATATGAATGCAATGAATGTCAGAAAGCCTTTAATACAAAGTCAAACCTTATGGTACATCA
GAGAACCCATACAGGGGAGAAACCTTATGTTTGTAGTGATTGTGGAAAAGCCTTTACATT
CAAGTCACAGCTCATTGTACATCAGGGGATTCACACAGGAGTAAAGCCCTATGGGTGTAT
TCAGTGTGGTAAAGGATTCAGTTTGAAATCACAGCTCATTGTACATCAGAGAAGTCACAC
AGGAATGAAACCTTATGTATGCAATGAATGTGGCAAAGCCTTCAGGAGCAAGTCATACCT
TATTATACATACAAGGACTCATACAGGAGAAAAACTCCATGAATGCAACAATTGTGGGAA
AGCCTTCAGTTTTAAATCACAGCTCATTATACATCAGAGGATTCATACAGGAGAGAACCC
CTATGAATGCCATGAATGTGGGAAAGCCTTCAGTCGGAAATACCAGCTTATTTCACACCA
GAGAACTCATGCAGGAGAGAAGCCTTATGAATGCACCGACTGTGGAAAGGCTTTTGGTTT
AAAGTCACAGCTTATTATACACCAGAGAACTCATACAGGGGAGAAACCATTTGAATGTAG
TGAGTGTCAGAAAGCCTTTAATACAAAGTCAAACCTGATTGTACATCAGAGAACTCATAC
AGGAGAGAAACCCTATAGTTGTAATGAATGTGGAAAAGCCTTTACGTTCAAATCACAGCT
CATTGTACATAAAGGAGTGCACACTGGAGTAAAACCCTATGGATGCAGTCAATGTGCAAA
AACCTTTAGTTTGAAGTCCCAGCTCATTGTACATCAGAGAAGTCACACAGGAGTAAAACC
ATATGGATGCAGTGAGTGTGGGAAAGCCTTCAGGAGCAAGTCATACCTTATTATACATAT
GAGAACTCATACAGGAGAGAAACCACATGAGTGCAGGGAATGCGGGAAATCCTTTAGTTT
CAATTCACAACTCATTGTGCATCAGAGAATTCACACAGGAGAAAATCCCTATGAATGCAG
TGAATGTGGGAAAGCCTTTAATAGGAAAGACCAGCTCATTTCACATCAGCGAACTCATGC
AGGGGAAAAGCCTTATGGGTGCAGTGAATGTGGGAAAGCTTTTAGCAGCAAGTCATACCT
AATTATACACATGAGAACTCATTCAGGTGAAAAACCATATGAATGTAATGAATGTGGGAA
AGCCTTCATTTGGAAATCACTACTCATTGTACATGAGCGAACTCATGCAGGGGTCAACCC
TTATAAATGCAGTCAATGTGAGAAATCCTTCAGTGGGAAATTACGCCTTCTTGTACACCA
GAGAATGCACACAAGAGAGAAACCATATGAATGCAGTGAGTGTGGAAAAGCCTTCATTAG
GAATTCTCAACTCATTGTACATCAAAGAACTCATTCAGGAGAGAAACCCTATGGGTGCAA
TGAATGTGGGAAAACCTTCTCTCAAAAATCAATTCTCAGTGCACATCAGAGAACACATAC
AGGAGAGAAGCCTTGTAAGTGCACTGAATGTGGGAAAGCCTTTTGTTGGAAGTCACAGCT
CATTATGCATCAGAGAACTCATGTAGATGACAAACATTGATAATTTTACGAAACTCTGAA
AAGTGGATTCACAAGAGATAGAAACAATCATATATAAAGAGAAACTCTGTAAGTGGAATC
ATCTTGTCATCTTCCAGAAAACTCATACTGAATAGAAACTTTATGAATGCACAGCATATG
GAAAGGCATCCACAGAAAGCTGTTCTTTACATGCAAAAAGATAGTAGACAATACACAGGA
AAACTGAATTTAGTAACCACTCTGAAAATTTTTAGCAGCAAGTCATACCTTTTTTTAAAA
AGTTCATACAGGTGAGGAACCATGTTAAACGTTGTAAAGTCATTTTACTAAAATAAGATT
CACAAAGAGGAAACTTCATGAACCAGATGAATATAGAATAGACTTCTTTGAAATTCATAG
TTTACAGAATTTTAATGAGAGAAATTATTGAGCTAATGAATGGCAGAATTAACAAAATTA
CAAACATTTTATGTATCGGAAGCATATACCTTGGAGGGACCATGCTATAAGGGAAAGTGT
AAATCTAGAAATGAGAAACCCCTAGGGAAAAAATATATATAGGAGTGAACATCTTATGAA
TGTACCAAATAAACCACAGCTGGACTGTTAACCTCACCTTAGAAGCTTCATTCTAAAAAA
AAAAAAAAAAAAAAAAAAAAAAACCAACCTGTTATTATATCTTAATATTAATTTTGAAGA
ATTATTTCTTTTAGGAATCATTTTAAGAAATTTTATTCCAGGTGTTCCAAAATTTCAGGA
AAAGGTTTGAGAAAATTCTCAATTATAAATAATAAGATACAGATTATTTCATTGTACAAG
TGAATCTAGTAAGGAGGTTAAGAATAAGAAATAACATCCCAGAGCCTACAGGGATATTTA
GATATCTTCCTATGTGTACTACATAATATGAATTTTGCAGTTTGGCATTTTACTTGCGAA
TGCCATATGTGAGACAAAAATCATCTTCCAGAGATTTCAGTATCTCTGATACTGACAATA
TCTCTGATATGACAATATCATCTTCCAGAGATTTCTACTCTGCATACCAACATTGTTTCT
TTGTGTCTTACCAAATGCAACTTGTTACTAGAATATGACTTACTAAAAATGCATTTCCAC
ACTGCAAACATTTTTTAGGGCTATCTTCTGCCCTTTGGAAGCAGTCTTGGCAGCAACCTC
TTTAGTAATCAATATAAGGCACACTTCATGTGTTTGTGTAGCCTGGAATCTATTCTACCT
TCACAGGTTAGAACATCTTGATTTCCTCTTAACGAAACATTCCCTAACGGTGTATGTAGT
CATGAGGGAACCACCATTCAAGATGCCCTGCTCAGGACTTGGCATGAGCACTATGGTCAG
CTGAGGCTCAGAACTGTACATTGTTAATGGGTTTTTCAAGTTCAGAAAAGCAACATGAGC
TTTTGTTCTGTGGTAGCATGTTGATGTAATAAGTAGCTATTTCAATAGAGGTTCCCAGAA
CAGCTTTTGTTACTGTCATTTTCTTAACTTTGTTCACTTGTCTTTTATTTTGAGCTATTG
GGTGTGCTTTTAATACATTCCTTGTTTGATTGCATTAGCCATTGTGTATCTTTTGCATAC
AGCTTACTAAATCAGATGGCTTCAGAAATGGGTGGTAGAGGAGTAGGCAGAAACTTGCAA
GGATATGTGGATATTTGGAAATGGTTGTTTCCCAAGACAGGATGGAAGTCTTTTAAGCAA
GAAACTTGGCCCATGCTATGAAGTCATGAAATGAATTGTTGGCATCATGTGCTCACTGAG
GCTTTGGGGAAATGGATAAGTTGTCATTGAAAAATTTTAAACAGAATTCTGGAGTGGTCA
AGAGGGGAATGCTTTTGATACCCATGTATAACATGGAGAATAATGATCTTAAAACTTCAA
TTTAAGATTATGTGTCAGTGATACTACTTAGTTACATGTAGCTATAGAGTCACAGTGGTG
AAAAACTCTGCCAGTTGCTTACTCACAAAGTTAGTTTTCTTCACTACCTCATCAGGTTTG
TTATGTGAGTGGGCATTAATCTGGGAAGAGTGGGACCCTGCCAGTTAGATTAGGGCTATC
TTGGAGGAATATGCGGATTCAATACTGCAAATATTTCTGAAACACCTTCTGCTTTGTACT
CTATTAGATACCCAAAGAAATTTTCATCCTTGAAGCGGAGGAATTTAATGATACCTGAAT
GCCTAACTGTTGTATTCTGCTTATACAGAATCCAATCTCAAGATACTTGGGGTGAAGAAT
GATGATTCACAGAAGGGAAGGGACATCTTACATAAACAAATAATCGCAGATACTTGCTAA
AGTGTATCCCCCAATCTGGGAAATACTGTAAAGGTGTATATTATTATTGATGTACCAAAG
AAGACAGAATAAATTCATAAGAGAAAGTTTATATTCAGTTTACTACTACCTAGGGTTAGA
TTTTAGTTTGTTGTTTTTTCAGATGCAAATCTACATGCAGCCTTGCCTGGTAGAAGCCAG
AAGTGTTGACAGTATTGAGGACAGCACTCACATACTGTGGGAAAGAATAATACTTGATTA
GGACTTATTATTTAATGAAATGAAAATTTTACAAAACAGAAA

Protein Sequence

>10795 : length: 947
MATRVRTASIWVPPLQERNSSWDRIRKLQGQESILGQGTPGLQPLPGTPRQKQKSRRIEK
VLEWLFISQEQPKITKSWGPLSFMDVFVDFTWEEWQLLDPAQKCLYRSVMLENYSNLVSL
GYQHTKPDIIFKLEQGEELCMVQAQVPNQTCPNTVWKIDDLMDWHQENKDKLGSTAKSFE
CTTFGKLCLLSTKYLSRQKPHKCGTHGKSLKYIDFTSDYARNNPNGFQVHGKSFFHSKHE
QTVIGIKYCESIESGKTVNKKSQLMCQQMYMGEKPFGCSCCEKAFSSKSYLLVHQQTHAE
EKPYGCNECGKDFSSKSYLIVHQRIHTGEKLHECSECRKTFSFHSQLVIHQRIHTGENPY
ECCECGKVFSRKDQLVSHQKTHSGQKPYVCNECGKAFGLKSQLIIHERIHTGEKPYECNE
CQKAFNTKSNLMVHQRTHTGEKPYVCSDCGKAFTFKSQLIVHQGIHTGVKPYGCIQCGKG
FSLKSQLIVHQRSHTGMKPYVCNECGKAFRSKSYLIIHTRTHTGEKLHECNNCGKAFSFK
SQLIIHQRIHTGENPYECHECGKAFSRKYQLISHQRTHAGEKPYECTDCGKAFGLKSQLI
IHQRTHTGEKPFECSECQKAFNTKSNLIVHQRTHTGEKPYSCNECGKAFTFKSQLIVHKG
VHTGVKPYGCSQCAKTFSLKSQLIVHQRSHTGVKPYGCSECGKAFRSKSYLIIHMRTHTG
EKPHECRECGKSFSFNSQLIVHQRIHTGENPYECSECGKAFNRKDQLISHQRTHAGEKPY
GCSECGKAFSSKSYLIIHMRTHSGEKPYECNECGKAFIWKSLLIVHERTHAGVNPYKCSQ
CEKSFSGKLRLLVHQRMHTREKPYECSECGKAFIRNSQLIVHQRTHSGEKPYGCNECGKT
FSQKSILSAHQRTHTGEKPCKCTECGKAFCWKSQLIMHQRTHVDDKH