ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10768

Name

AHCYL1

Synonym

DCAL|IRBIT|PPP1R78|PRO0233|XPVKONA;adenosylhomocysteinase-like 1;AHCYL1;adenosylhomocysteinase-like 1

Definition

DC-expressed AHCY-like molecule|IP(3)Rs binding protein released with IP(3)|S-adenosyl homocysteine hydrolase homolog|S-adenosyl-L-homocysteine hydrolase 2|S-adenosylhomocysteine hydrolase-like protein 1|adoHcyase 2|dendritic cell expressed AHCY-like prot

Position

1p13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

methionine degradation I (to homocysteine);BioCyc;METHIONINE-DEG1-PWY

Pathway

Selenoamino acid metabolism;KEGG PATHWAY;hsa00450

Pathway

cysteine biosynthesis III (mammalia);BioCyc;PWY-6292

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

Cysteine and methionine metabolism;KEGG PATHWAY;hsa00270

Pathway

superpathway of methionine degradation;BioCyc;PWY-5328

External Links

Links to cell senescence gene database

10768

Links to epithelial mesenchymal transition gene database

10768

Links to ovarian cancer gene database

10768

Links to endometrial cancer gene database

10768

Links to iHOP

10768

Sequence Information

Nucleotide Sequence

>10768 : length: 4320
GCTTTGCGTGCGTGTTTGCGTACAGCGGAGGTGGCGGCGCGGGCAGGTCGGAGCTCGGAG
CTGCTGCTTCTGGTTCTCTTGTGGCCGCCGTCGCTGTCCGGCTGCCTTGGGCTGCCGAAC
AGACAAGGCGTGGGCCACAGCACCTCAGAAGCCGACGCAGCTCGACGCAGGGGCCGGCAG
GAGGGTGGGCGATCGCGTGTCGGAGGGCGCCGCGCGGGCAGGCGGGCGGGCGCCAGAGGG
GGAAAGAGGCGGGGGCGGCGGGTCAGCCGCTGGCCGGGCCGGCCGGGGAATGTCGATGCC
TGACGCGATGCCGCTGCCCGGGGTCGGGGAGGAGCTGAAGCAGGCCAAGGAGATCGAGGA
CGCCGAGAAGTACTCCTTCATGGCCACCGTCACCAAGGCGCCCAAGAAGGTGCGGGGGCT
CTGGGTGGCGGCGGGGGCTCGGGCTCCGGCCTCGCGGAAGGGACGCGAGCAAGCCCGGGC
TCTGGCTAGTTTGGGACTTCTGGGGGTGACTGGGGACGGCGGAGGTGATGTAGGGGGTGG
CGGCTGTGCGGCCCCAGGCCTCTCCCGGGCTGAAAGGCCGCCTCTGACCTCGCTTTCCTT
TGTCCCTCGGCCCAAGTCCTCCGGGATCGTTTTGAAACCCGACAGGGCCAGGCCTTAAAT
TTGCGACTGACTTTTCCTGGATGAAGGGCCTCGAAGACGAGAGTGGGAGGGGGTGAACCA
ACTCAGCTGACCCTTGTGACCAGTCCGGGGGCATGGGGTGTACAGAAAATCTCCCTTCAG
CAAATCCAGTTTGCTGATGACATGCAGGAGTTCACCAAATTCCCCACCAAAACTGGCCGA
AGATCTTTGTCTCGCTCGATCTCACAGTCCTCCACTGACAGCTACAGTTCAGCTGCATCC
TACACAGATAGCTCTGATGATGAGGTTTCTCCCCGAGAGAAGCAGCAAACCAACTCCAAG
GGCAGCAGCAATTTCTGTGTGAAGAACATCAAGCAGGCAGAATTTGGACGCCGGGAGATT
GAGATTGCAGAGCAAGACATGTCTGCTCTGATTTCACTCAGGAAACGTGCTCAGGGGGAG
AAGCCCTTGGCTGGTGCTAAAATAGTGGGCTGTACACACATCACAGCCCAGACAGCGGTG
TTGATTGAGACACTCTGTGCCCTGGGGGCTCAGTGCCGCTGGTCTGCTTGTAACATCTAC
TCAACTCAGAATGAAGTAGCTGCAGCACTGGCTGAGGCTGGAGTTGCAGTGTTCGCTTGG
AAGGGCGAGTCAGAAGATGACTTCTGGTGGTGTATTGACCGCTGTGTGAACATGGATGGG
TGGCAGGCCAACATGATCCTGGATGATGGGGGAGACTTAACCCACTGGGTTTATAAGAAG
TATCCAAACGTGTTTAAGAAGATCCGAGGCATTGTGGAAGAGAGCGTGACTGGTGTTCAC
AGGCTGTATCAGCTCTCCAAAGCTGGGAAGCTCTGTGTTCCGGCCATGAACGTCAATGAT
TCTGTTACCAAACAGAAGTTTGATAACTTGTACTGCTGCCGAGAATCCATTTTGGATGGC
CTGAAGAGGACCACAGATGTGATGTTTGGTGGGAAACAAGTGGTGGTGTGTGGCTATGGT
GAGGTAGGCAAGGGCTGCTGTGCTGCTCTCAAAGCTCTTGGAGCAATTGTCTACATTACC
GAAATCGACCCCATCTGTGCTCTGCAGGCCTGCATGGATGGGTTCAGGGTGGTAAAGCTA
AATGAAGTCATCCGGCAAGTCGATGTCGTAATAACTTGCACAGGAAATAAGAATGTAGTG
ACACGGGAGCACTTGGATCGCATGAAAAACAGTTGTATCGTATGCAATATGGGCCACTCC
AACACAGAAATCGATGTGACCAGCCTCCGCACTCCGGAGCTGACGTGGGAGCGAGTACGT
TCTCAGGTGGACCATGTCATCTGGCCAGATGGCAAACGAGTTGTCCTCCTGGCAGAGGGT
CGTCTACTCAATTTGAGCTGCTCCACAGTTCCCACCTTTGTTCTGTCCATCACAGCCACA
ACACAGGCTTTGGCACTGATAGAACTCTATAATGCACCCGAGGGGCGATACAAGCAGGAT
GTGTACTTGCTTCCTAAGAAAATGGATGAATACGTTGCCAGCTTGCATCTGCCATCATTT
GATGCCCACCTTACAGAGCTGACAGATGACCAAGCAAAATATCTGGGACTCAACAAAAAT
GGGCCATTCAAACCTAATTATTACAGATACTAATGGACCATACTACCAAGGACCAGTCCA
CCTGAACCACACACTCTAAAGAAATATTTTTTAAGATAACTTTTATTTTCTTCTTACTCC
TTTCCTCTTGATTTTTTTCCTATAATTTCATTCTTGTTTTTTCATCTCATTATCCAAGTT
CTGCAGACCACACAGGAACTTGCTTCATGGCTCTTTAGATGAAATAGAAGTTCAGGGTTC
CTCACTCTAGTCACTAAAGAAGGATTTTACTCTCCCAGCCCAGAAAGGTGATTCTTTCTT
TACCATTTCTGGGGACTTTAGTCTTAATTAGGTACCTTATTAACAGGAAATGCTAAGGTA
CCTTCTCTGTGGAACAATCTGCAATGTCTAAATCGCCTTAAAAGAGCCCATTTCTTAGCT
GCTGAAATCAGTGCTCTTTCACTTCTTCAGAGAAGCAGGGATGGTACCTACCCGGCAGGT
AGGTTAGATGTGGGTGGTGCATGTTAATTTCCCTTAGAAGTTCCAAGCCCTGTTTCCTGC
GTAAAGGTGGTATGTCCAGTTCAGAGATGTGTATAATGAGCATGGCTTGTTAAGATCAGG
AGGCCCACTTGGATTTATAGTATAGCCCTTCCTCCACTCCCACCAGACTTGCTCATTTTT
CGAGTTTTTAACTAGACTACACTCTATTGAGTTTAATTTTGTCCTCTAGGATTTATTTCT
GTTGTCCAAAAAAAAAAAAAAAGAAAAGAAAAATTAAGGAGAATTTTTGGTGTTAATGCT
GAGGAATTGCTTGAGTGGTTAGTTGTTACCAATTTCTCTTTTGAACCTTTGGAGCTAAGG
ATGCTGAGTCTAGAGAAATGCTAGTCTCAAGCCCTGTTAAGTCCCTCTGTTTCTAGCCCG
TAGTTCATAGCATCAGTGAACTGGAGCCACAACAGCAAATTCTATCAGCTGTGTACCATA
CAGCTTGTGCTGAAGGCGAATTTCTTGAGCCATTACTCAGTATAAAGCACTGAGTTCTAT
CTTTAGGATTTATCTTTAAGAGCAAATTTCTGGTCAGCTGTGCTTCTGCAACCTAAAATA
TTTAAAGGGAGGTAGGTGTGGGCAGGAGGAGGAATGATAAATTGGGCCAGGGCAAGAAAA
ATCTAGCTTCATATAATTTGTCTGGGACTATACACCCTATATAATGTTAGTTTTACAGAA
GTAATATGACTTTTGATTGCTACATACCACAAAGAGTTTATGAACTGAGATCATAAAGGG
CAACTGATGTGTGAAGAAAGTAGTCAGTACATCCTGGCTCATGCTCTGAAAGAATATCCA
GAGAGGCTCTCTCAAAGATCAGGGAGATGTATTCCCATGCCATGCACCCTGCTTCCCAGC
ATTTCTGCATGGTCAAGTGAGCTTTATGCTCATGAGCTTTAAGTATATAATTATCCAGGA
TTTTAAATCCTCAACTTGTTCTAGCTTGTGATCCCTCAAAGTTGGGTCATACGTTAGTGC
TAGATACTAGAAATTTTCACTTTTCCACTGATCAGAGAGACAGACATTAAAAACAAAAAT
AGAAGAAAGGAAAGCTTTCACCCTGCAGCTTCTTAGCAGGGAACAATTGTCTTGCCAAAA
CTTTTTTCCCTTTTCTCTCCCATTTTCTTTTACCCAATCCCTTCTTACTCCTTGCCAGTG
TGACCATGCTTTCTTCTCTGTAGATGTTAACAGTTAAGGCCTATTTTCCTCGGGCACTTA
ACCAACCAATCAGAACACCACATCTGTTAGGGGAGGTAACCTGGCCAACAGTGTATCCAT
CACGTTAGCCCTGCTGGAGGGAAGGGACCCACATTCACCTGCCCTCTGACCTGCCCCTTG
ATCCCATATCTATTACCGTGTCCATAGGAATAATAGGTAAGGGCTCTGTCTCTGTCAAGC
CATGTAACAAAGGACACTGTTAAAAAAAAAAAAAAGTCTGGCATCAGAGGGAGCATGTGG
AGAGCAACTTGGGAAGAACAAGTTCATTTTGTATTGAATGATTTTTAATGAATGCAATAT
TAATCCTTGCAGATGAGCAATAATCATTAAAATCGATTAAAATGATAAGACCTTAAAAAA

Protein Sequence

>10768 : length: 530
MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGR
RSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREI
EIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIY
STQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMDGWQANMILDDGGDLTHWVYKK
YPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDG
LKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKL
NEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVR
SQVDHVIWPDGKRVVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQD
VYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY