ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10765

Name

KDM5B

Synonym

CT31|JARID1B|PLU-1|PLU1|PPP1R98|PUT1|RBBP2H1A;lysine (K)-specific demethylase 5B;KDM5B;lysine (K)-specific demethylase 5B

Definition

RBP2-H1|cancer/testis antigen 31|histone demethylase JARID1B|jumonji, AT rich interactive domain 1B|jumonji/ARID domain-containing protein 1B|lysine-specific demethylase 5B|protein phosphatase 1, regulatory subunit 98|putative DNA/chromatin binding motif|

Position

1q32.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10765

Links to epithelial mesenchymal transition gene database

10765

Links to ovarian cancer gene database

10765

Links to endometrial cancer gene database

10765

Links to iHOP

10765

Sequence Information

Nucleotide Sequence

>10765 : length: 6539
GACGTCGTCGTCGGAGGCTGAAAAAGCCCAAGGTGCTGCCGTTGCCCGTACAACTCGGAC
TTGCTGTTGCTCGAGCCGCGTCTGCACGGGTCTCGGACCGAGCGGAGCTCGCAGCCTCGG
TCCCGGAGCCCACCTTCGCCTCGCCCTTGCCCAGCCTGCGGTGATGGAGGCGGCCACCAC
ACTGCACCCAGGCCCGCGCCCGGCGCTGCCCCTCGGGGGCCCGGGCCCGCTGGGCGAGTT
CCTGCCTCCACCCGAGTGCCCGGTCTTCGAACCCAGCTGGGAAGAGTTCGCGGACCCCTT
CGCTTTCATCCACAAGATCCGGCCCATAGCCGAGCAGACTGGCATCTGTAAGGTGCGGCC
GCCGCCGGATTGGCAGCCACCATTTGCATGTGATGTTGATAAACTTCATTTTACGCCACG
TATCCAGAGACTGAATGAATTGGAGGCCCAAACTCGTGTAAAATTGAATTTCTTGGACCA
GATTGCAAAGTACTGGGAGTTACAGGGAAGTACTCTGAAAATTCCACATGTGGAGAGGAA
GATCTTGGACTTATTTCAGCTTAATAAGTTAGTTGCAGAAGAAGGTGGATTTGCAGTTGT
TTGCAAGGATAGAAAATGGACCAAAATTGCTACCAAGATGGGGTTTGCTCCTGGCAAAGC
AGTGGGCTCACATATCAGAGGGCATTATGAACGAATTCTCAACCCCTACAACTTATTCCT
GTCCGGAGACAGCCTAAGGTGTTTGCAGAAGCCAAACCTGACCACAGACACTAAGGACAA
GGAGTACAAACCCCATGATATTCCCCAGAGGCAGTCTGTGCAGCCTTCGGAAACGTGCCC
CCCAGCCCGACGAGCAAAACGCATGAGAGCAGAGAGACAGAGTCTCGCTGTGTTGCCCAG
GCTGGAGTGCAGTGGCGCGATCTTGGCTCACTGCAACCTCCGCCTCCTAGATTCCAGCAA
TTCTTCTGCCTCAGCCTCCCAAGCCATGAATATTAAAATAGAACCCGAGGAGACAACGGA
AGCCAGAACTCATAATCTGAGACGTCGAATGGGTTGTCCAACTCCAAAATGTGAAAATGA
GAAAGAAATGAAGAGTAGCATCAAGCAAGAACCTATTGAGAGGAAAGATTATATTGTAGA
AAATGAGAAGGAAAAGCCCAAGAGTCGATCTAAAAAAGCCACCAATGCTGTGGACCTGTA
TGTCTGTCTTTTATGTGGCAGTGGCAATGATGAAGACCGGCTACTGTTGTGTGATGGCTG
TGATGACAGTTACCATACCTTTTGCTTGATCCCACCTCTCCATGATGTTCCCAAGGGAGA
CTGGAGGTGTCCTAAGTGTTTGGCTCAGGAATGTAGTAAGCCACAAGAAGCATTTGGCTT
TGAACAAGCAGCCAGGGACTATACCCTCCGTACTTTTGGGGAAATGGCAGATGCGTTCAA
ATCTGATTACTTCAACATGCCAGTCCATATGGTCCCCACAGAGCTTGTTGAGAAAGAATT
TTGGAGACTAGTAAGCACTATTGAGGAGGATGTCACAGTGGAATATGGAGCTGACATTGC
CTCAAAGGAATTTGGCAGTGGCTTTCCTGTCCGAGATGGGAAAATCAAACTCTCACCTGA
GGAAGAGGAGTATCTTGATAGTGGCTGGAATTTGAACAACATGCCAGTGATGGAGCAGTC
TGTCCTTGCACATATTACTGCTGATATATGTGGCATGAAACTTCCTTGGTTGTATGTGGG
AATGTGCTTTTCTTCATTCTGTTGGCACATTGAAGACCACTGGAGCTATTCAATTAACTA
CTTGCACTGGGGTGAGCCAAAAACCTGGTATGGAGTCCCAGGGTATGCTGCTGAGCAGCT
AGAAAATGTAATGAAGAAACTAGCTCCAGAACTCTTTGTGTCCCAGCCGGATCTCCTCCA
TCAGCTTGTGACCATCATGAACCCCAATACCCTGATGACTCATGAAGTGCCTGTTTACCG
AACTAATCAGTGTGCTGGGGAGTTTGTGATTACATTTCCAAGAGCCTACCACAGTGGTTT
TAACCAGGGTTTTAATTTTGCTGAGGCTGTTAACTTCTGCACTGTTGATTGGCTGCCATT
AGGCCGACAGTGTGTGGAGCATTATCGCTTGCTTCATCGATATTGTGTGTTTTCCCACGA
TGAGATGATCTGCAAGATGGCTTCCAAGGCTGATGTATTAGATGTTGTAGTGGCTTCAAC
TGTTCAGAAAGACATGGCCATTATGATTGAGGATGAGAAAGCTTTAAGAGAAACTGTCCG
TAAATTGGGAGTGATTGATTCGGAAAGAATGGATTTTGAGCTGTTGCCAGATGATGAACG
TCAGTGTGTAAAATGCAAAACTACATGCTTCATGTCTGCCATCTCCTGTTCTTGTAAACC
TGGCCTTCTTGTTTGCCTGCATCATGTAAAAGAATTGTGTTCCTGTCCTCCTTACAAATA
TAAATTGCGGTATAGGTACACGCTGGATGATCTCTACCCTATGATGAATGCATTGAAGCT
TCGAGCAGAATCTTACAACGAATGGGCCTTGAATGTGAATGAAGCTTTGGAGGCAAAGAT
CAACAAGAAGAAAAGCCTTGTCAGCTTCAAGGCTTTAATTGAAGAATCTGAAATGAAGAA
ATTCCCAGACAATGATCTTTTGCGACACCTTCGCCTAGTCACACAGGATGCAGAGAAGTG
TGCCTCTGTTGCGCAGCAGTTGCTTAATGGCAAAAGGCAAACTAGATATCGATCTGGTGG
AGGGAAATCCCAAAATCAGTTGACAGTGAATGAGCTCCGGCAGTTTGTAACACAGCTGTA
TGCTCTTCCATGTGTCCTCAGTCAGACACCATTACTAAAGGATCTCTTGAATCGTGTAGA
AGATTTTCAACAGCATAGTCAGAAACTACTCTCTGAGGAAACGCCTAGTGCTGCGGAGCT
GCAGGACTTGCTAGATGTCAGCTTTGAATTTGATGTTGAACTTCCACAGCTTGCTGAGAT
GCGTATCCGTTTGGAACAAGCCCGTTGGCTAGAAGAGGTGCAGCAAGCTTGCCTAGACCC
CAGCTCCCTTACTTTAGATGATATGAGACGTCTCATAGACCTAGGGGTAGGGCTGGCCCC
GTATTCAGCAGTGGAGAAAGCTATGGCCCGGCTGCAGGAACTGCTCACAGTGTCAGAGCA
CTGGGACGACAAAGCCAAGAGTCTCCTCAAGGCCAGGCCACGACATTCATTGAATAGCCT
TGCTACGGCAGTAAAGGAAATCGAAGAGATCCCTGCATATCTGCCCAATGGTGCGGCTCT
GAAAGACTCAGTGCAGAGAGCCAGAGACTGGCTTCAGGATGTAGAGGGCCTGCAGGCTGG
AGGACGTGTGCCAGTGTTAGACACACTCATAGAACTTGTTACACGAGGCCGATCTATCCC
CGTACATCTGAATTCTTTGCCAAGACTGGAAACCCTAGTAGCTGAGGTTCAGGCTTGGAA
AGAATGTGCTGTTAATACATTCTTGACTGAGAATTCTCCATATTCTCTCTTAGAGGTGCT
GTGTCCTCGATGTGATATTGGCCTTTTGGGATTGAAAAGGAAGCAGAGAAAGTTAAAGGA
GCCCTTGCCAAATGGAAAGAAAAAAAGCACCAAATTAGAGAGTCTGAGTGACCTGGAGAG
AGCTTTAACTGAAAGCAAGGAGACTGCTTCAGCTATGGCAACTCTTGGGGAAGCTCGCCT
AAGGGAAATGGAAGCCTTGCAGTCTCTCAGACTCGCCAATGAAGGGAAATTGCTGTCGCC
TCTCCAAGATGTGGATATAAAAATCTGCCTATGTCAGAAGGCCCCAGCTGCCCCTATGAT
TCAATGTGAACTCTGCAGGGATGCTTTCCACACCAGTTGTGTGGCGGTACCCAGTATTTC
ACAGGGCCTGCGAATCTGGCTTTGTCCCCATTGTCGGAGGTCAGAGAAACCTCCATTAGA
GAAAATTCTGCCCCTGCTCGCCTCCCTTCAGCGTATCCGAGTTCGCCTTCCTGAGGGAGA
TGCACTTCGATATATGATTGAAAGAACCGTGAACTGGCAGCACAGAGCCCAGCAACTGCT
TTCGTCAGGGAATCTTAAATTTGTGCAAGATCGAGTGGGCTCAGGACTGTTATATAGCAG
ATGGCAAGCCTCAGCAGGACAGGTGTCAGACACAAACAAGGTATCTCAACCTCCTGGCAC
AACATCATTTTCTTTGCCTGATGACTGGGACAACAGAACCTCATATTTGCACTCCCCCTT
CTCAACTGGACGAAGTTGTATCCCCCTCCATGGTGTTAGTCCAGAAGTGAATGAACTATT
GATGGAAGCCCAGCTGCTCCAGGTATCCCTTCCTGAAATTCAGGAACTTTACCAGACTTT
ACTTGCAAAGCCAAGCCCTGCTCAGCAGACTGACCGAAGCTCACCAGTGAGACCCAGCAG
TGAGAAGAATGACTGTTGCCGAGGGAAGCGAGATGGAATTAACAGTCTTGAGAGAAAACT
GAAGAGACGCCTGGAAAGAGAGGGCCTCTCCAGTGAGCGGTGGGAACGAGTTAAGAAAAT
GCGGACCCCCAAAAAGAAGAAAATCAAACTGAGCCACCCCAAGGACATGAACAATTTCAA
GTTAGAGAGAGAGCGTAGCTATGAATTAGTTCGTTCTGCTGAAACTCATTCCCTGCCCTC
AGACACATCCTATTCCGAACAGGAAGACTCTGAGGATGAAGATGCCATCTGCCCAGCTGT
GAGCTGCCTGCAGCCAGAAGGAGATGAGGTGGACTGGGTCCAGTGTGATGGCAGCTGCAA
TCAGTGGTTTCATCAGGTCTGTGTTGGTGTCTCCCCAGAGATGGCAGAGAAAGAAGACTA
CATCTGTGTGCGCTGTACTGTGAAGGACGCACCAAGCCGAAAGTAAAAACACAAAAACAG
ATACCCCCCTACTTAATGTAATTCAGGACTCCAACCAAGAGGATTTCTTCAAATCTCAGC
AAAGCTACAGGACTGGTACTCAAGCCAGCCTGTAAACGGTGCTATTTCTATTCCTTATGG
GATCATTTTTCCAGGACTCTTTGAAGAAAAGAAAAAACAACTAAAAAAATTTTTGACACT
TTTTGTATTTTTTCCTTAAGAGCTATTTGTGGTTGTTGAGGTTTGAAAAGCTGACTGTTT
TTTTTGCAGGGGTTCCCACCAATTTGGAAGGCATTGAAGCTTGCACCTTTTCATGTACAG
CATTAAAATTTTACCTCTCTCTGGGATTTACCAGCTTAAGAGTCCAACTCACTTCCAGTG
CCCAAAAGGGCACCCACCAGAAATTCCAGTAAATCCTCATTTGAGGAAGCTCTCCCTTGT
TTACTCTGTTACCACATTGGGGAAATTTTTAAGTTTTTCACTTTGGGAGTTTTTGTTTGT
TTCTTCTTTTCCTTTATCCACTTTTCTTCTTCCTGGTAGACTAGGTTTATTTATCTGAGC
AATAACTTCTATGTTGGTTTCAGTGGCTGGAATTAAAACAAAACAAAACAAACTTCCAAA
CAGTGTGTTGGTGCTTTAGCGATTGATTGATGTACAGAACACAAATGTCTAGTTTCTAGT
GTCACTGATGAACTAGTGATGTAGAAAAGAGACTTCTCTGTAAGTAATTGCCACAGCTGT
ATTTTGGCTTTCTCCCTGTCCCTTCCTTTCTCCCCTATTTTTTGGTAGCTTGTATCAAAT
GTTACAGTTTATATTGTGGAATAAATCCTTCGTCCTAACATAACACTAAATGCTGATTAT
TTAGAGCCATTAGAGCACAGCTTCTTCTGCCCCTCTACTGTTGCACAGCCAGAAGGGGCT
GCTTGCTTTTGCCTCTGCCCAACCAGGTTGCAGTAGCAGTGGATGTTAGCCTGCAAACAA
CATTAGGGGATTCTTCTTTTGTGTCCTGCTCTGTTTGGTGGGCCATATGCCTACAGCCCT
CACTAACAAAGAACCCCTCTGTCTTCAAGGACTAGAACCTATCTTTAAAGCCGTGCTCTT
TTAAAATAAGCTTTCTCAGAATGTTGGCAAATCACTTCAATCCTCAAATCAGTCTTCCTT
GTGGAATGCTGCCTTTATTATATTTGAATTGACAGGGGAACTTGGTTTAGGGTTAAGACG
TTGGAAGGAAATCTAAGGAAAATTAATCCTCACAGAGGTCCGGGTTTAGTATATGTCTTG
AGAGGAGACTTGTGAATTCCCAGACTCTGCCTCCTGGTTTCCTTTCTCATTTCTTTCTAA
CTGTAGCTATCATTACTGGCTGTGGATAGCCCATAGCTATTTTCCTTGCTTTTCTTTTTT
AAAGGGGTCTGTTCTGCAGTGGAGAAGACATTCTGGTGACCAGACTTTTGCTTACCTTTT
CCTATTCTGTTGCCAATTTTTGTTTTCCCCACATTCTATAGCCATAAACCTGAAGATGAG
TAAAACTGGTGGGTCTTTAATAAAACAACAACAAAAACAGCAGTTTGTGATATAGCAGAG
GTTTAAATGTACCCTCCCCTTTTATGCACTTCAAATAATTAAATCTCTTTAAGAATGAC

Protein Sequence

>10765 : length: 1580
MEAATTLHPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTG
ICKVRPPPDWQPPFACDVDKLHFTPRIQRLNELEAQTRVKLNFLDQIAKYWELQGSTLKI
PHVERKILDLFQLNKLVAEEGGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILN
PYNLFLSGDSLRCLQKPNLTTDTKDKEYKPHDIPQRQSVQPSETCPPARRAKRMRAERQS
LAVLPRLECSGAILAHCNLRLLDSSNSSASASQAMNIKIEPEETTEARTHNLRRRMGCPT
PKCENEKEMKSSIKQEPIERKDYIVENEKEKPKSRSKKATNAVDLYVCLLCGSGNDEDRL
LLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQECSKPQEAFGFEQAARDYTLRTFGE
MADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDGK
IKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHW
SYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTH
EVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRY
CVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFEL
LPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPM
MNALKLRAESYNEWALNVNEALEAKINKKKSLVSFKALIEESEMKKFPDNDLLRHLRLVT
QDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLYALPCVLSQTPLLKD
LLNRVEDFQQHSQKLLSEETPSAAELQDLLDVSFEFDVELPQLAEMRIRLEQARWLEEVQ
QACLDPSSLTLDDMRRLIDLGVGLAPYSAVEKAMARLQELLTVSEHWDDKAKSLLKARPR
HSLNSLATAVKEIEEIPAYLPNGAALKDSVQRARDWLQDVEGLQAGGRVPVLDTLIELVT
RGRSIPVHLNSLPRLETLVAEVQAWKECAVNTFLTENSPYSLLEVLCPRCDIGLLGLKRK
QRKLKEPLPNGKKKSTKLESLSDLERALTESKETASAMATLGEARLREMEALQSLRLANE
GKLLSPLQDVDIKICLCQKAPAAPMIQCELCRDAFHTSCVAVPSISQGLRIWLCPHCRRS
EKPPLEKILPLLASLQRIRVRLPEGDALRYMIERTVNWQHRAQQLLSSGNLKFVQDRVGS
GLLYSRWQASAGQVSDTNKVSQPPGTTSFSLPDDWDNRTSYLHSPFSTGRSCIPLHGVSP
EVNELLMEAQLLQVSLPEIQELYQTLLAKPSPAQQTDRSSPVRPSSEKNDCCRGKRDGIN
SLERKLKRRLEREGLSSERWERVKKMRTPKKKKIKLSHPKDMNNFKLERERSYELVRSAE
THSLPSDTSYSEQEDSEDEDAICPAVSCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEM
AEKEDYICVRCTVKDAPSRK