ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10752

Name

CHL1

Synonym

CALL|L1CAM2;cell adhesion molecule L1-like;CHL1;cell adhesion molecule L1-like

Definition

L1 cell adhesion molecule 2|cell adhesion molecule with homology to L1CAM (close homolog of L1)|cell adhesion molecule with homology to L1CAM (close homologue of L1)|close homolog of L1|neural cell adhesion molecule L1-like protein

Position

3p26.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

CHL1 interactions;PID Reactome;500101

Disease

Schizophrenia;FunDO

Disease

PSYCH;GAD

Disease

schizophrenia;GAD

Disease

Angiomyolipoma;FunDO

External Links

Links to cell senescence gene database

10752

Links to epithelial mesenchymal transition gene database

10752

Links to ovarian cancer gene database

10752

Links to endometrial cancer gene database

10752

Links to iHOP

10752

Sequence Information

Nucleotide Sequence

>10752 : length: 8031
AGGGATCCTACCTCTTTTGACCGGAGATGTTGAAAAGCACGACCAAAGTTTTTGGCTTGG
TCTCTTGCTTTCCACAACGAGATAAAGTCTGAAGCCTGTAACTCTCCCTGTCCCGCGGGA
GCGTGCAAAGGGAGGGAAGATAAGCGGCGTGGGTGAGGGGTGGCGGCGCAGAACCCAGGA
AGGGAGCAGAGGCGAGAGCCAGCCTCCGGCAGGAGGGCGTAGACCCCGGTGCCAGCCAGA
ACGGCTCCAGCCTTCCCGCGGCCAGAGAGCCAGCGGCGGGAGGGGACGGGCGGGACCTCC
GCGGACAGCCCCGGGTGCGGACCAGCGGGCAGCGGCCGGCGAGACCCTCCCTGGATCCGC
CCAGAGCTTACCGGACCCTGCGCGCCCCCGTCCCGGCTCCCGGCCGGCTCGGGGGAGAAG
GCGCCCGAGGGGAGGCGCCGGACAGATCGCGTTTCGGAGGCGGCGCAGGTGCTGTAAACT
GCAAACCATAATCCTGTCTTAATACTGCAAACAAATCATAGTGGAACTAAGGGGAACTTA
ATTTACTGTTTCCAGGTTAACTAAGGTCTCAGCTGTAAACCAAAAGTGAGAGGAGACATT
AAGATTTTCATTCTTACCGGGTTGTCTTCTTCCTGAAGAGCAATGGAGCCGCTTTTACTT
GGAAGAGGACTAATCGTATATCTAATGTTCCTCCTGTTAAAATTCTCAAAAGCAATTGAA
ATACCATCTTCAGTTCAACAGGTTCCAACAATCATAAAACAGTCAAAAGTCCAAGTTGCC
TTTCCCTTCGATGAGTATTTTCAAATTGAATGTGAAGCTAAAGGAAATCCAGAACCAACA
TTTTCGTGGACTAAGGATGGCAACCCTTTTTATTTCACTGACCATCGGATAATTCCATCG
AACAATTCAGGAACATTCAGGATCCCAAACGAGGGGCACATATCTCACTTTCAAGGGAAA
TACCGCTGCTTTGCTTCAAATAAACTGGGAATCGCTATGTCAGAAGAAATAGAATTTATA
GTTCCAAGTGTTCCAAAATTCCCAAAAGAAAAAATTGACCCTCTTGAAGTGGAGGAGGGA
GATCCAATTGTCCTCCCATGCAATCCTCCCAAAGGCCTCCCACCTTTACACATTTATTGG
ATGAATATTGAATTAGAACACATCGAACAAGATGAAAGAGTATACATGAGCCAAAAGGGA
GATCTATACTTCGCAAACGTGGAAGAAAAGGACAGTCGCAATGACTACTGTTGCTTTGCT
GCATTTCCAAGATTAAGGACTATTGTACAGAAAATGCCAATGAAACTAACAGTTAACAGT
TTAAAGCATGCTAATGACTCAAGTTCATCCACAGAAATTGGTTCCAAGGCAAATTCCATC
AAGCAAAGAAAACCCAAACTGCTGTTGCCTCCCACTGAGAGTGGCAGTGAGTCTTCAATT
ACCATCCTCAAAGGGGAAATCTTGCTGCTTGAGTGTTTTGCTGAAGGCTTGCCAACTCCA
CAGGTTGATTGGAACAAAATTGGTGGTGACTTACCAAAGGGGAGAGAAACAAAAGAAAAT
TATGGCAAGACTTTGAAGATAGAGAATGTCTCCTACCAGGACAAAGGAAATTATCGCTGC
ACAGCCAGCAATTTCTTGGGAACAGCCACTCACGATTTTCACGTTATAGTAGAAGAGCCT
CCTCGCTGGACAAAGAAGCCTCAGAGTGCTGTGTATAGCACCGGAAGCAATGGCATCTTG
TTATGTGAGGCTGAAGGAGAACCTCAACCCACAATCAAGTGGAGAGTCAATGGCTCCCCA
GTTGACAATCATCCATTTGCTGGTGATGTTGTCTTCCCCAGGGAAATCAGTTTTACCAAC
CTTCAACCAAATCATACTGCTGTGTACCAGTGTGAAGCCTCAAATGTCCATGGAACTATC
CTTGCCAATGCCAATATTGATGTTGTGGATGTCCGTCCATTGATACAAACCAAAGATGGA
GAAAATTACGCTACAGTGGTTGGGTACAGTGCTTTCTTACATTGCGAGTTCTTTGCTTCA
CCTGAGGCAGTCGTGTCCTGGCAGAAGGTGGAAGAAGTGAAACCCCTGGAGGGCAGGCGG
TATCATATCTATGAAAATGGCACATTGCAGATCAACAGAACCACCGAAGAAGATGCTGGG
TCTTACTCATGTTGGGTAGAAAATGCTATAGGAAAAACTGCAGTCACAGCCAATTTGGAT
ATTAGAAATGCTACAAAACTTAGAGTTTCTCCTAAGAATCCTCGTATCCCCAAATTGCAT
ATGCTTGAATTACATTGTGAAAGCAAATGTGACTCACATTTGAAACACAGTTTGAAGTTG
TCCTGGAGTAAAGATGGAGAAGCCTTTGAAATTAATGGCACAGAAGATGGCAGGATAATT
ATTGATGGAGCTAATTTGACCATATCTAATGTAACTTTAGAGGACCAAGGTATTTACTGC
TGTTCAGCTCATACTGCTCTAGACAGTGCTGCCGATATAACTCAAGTAACTGTTCTTGAT
GTTCCGGATCCACCAGAAAACCTTCACTTGTCTGAAAGACAGAACAGGAGTGTTCGGCTG
ACCTGGGAAGCTGGAGCTGACCACAACAGCAATATTAGCGAGTATATTGTTGAATTTGAA
GGAAACAAAGAAGAGCCTGGAAGGTGGGAGGAACTGACCAGAGTCCAAGGAAAGAAAACC
ACAGTTATCTTACCTTTGGCTCCATTTGTGAGATACCAGTTCAGGGTCATAGCCGTGAAC
GAAGTAGGGAGAAGTCAGCCTAGCCAGCCGTCAGACCATCATGAAACACCACCAGCAGCT
CCAGATAGGAATCCACAAAACATAAGGGTTCAAGCCTCTCAACCCAAGGAAATGATTATA
AAGTGGGAGCCTTTGAAATCCATGGAGCAGAATGGACCAGGCCTAGAGTACAGAGTGACC
TGGAAGCCACAGGGAGCCCCAGTGGAGTGGGAAGAAGAAACAGTCACAAACCACACATTG
CGGGTGATGACGCCTGCTGTCTATGCCCCTTATGATGTCAAGGTCCAGGCTATCAATCAA
CTAGGATCTGGGCCTGACCCTCAGTCAGTGACTCTCTATTCTGGAGAAGACTATCCTGAT
ACAGCTCCAGTGATCCATGGGGTGGACGTTATAAACAGTACATTAGTTAAAGTTACCTGG
TCAACAGTTCCAAAGGACAGAGTACATGGACGTCTGAAAGGCTATCAGATAAATTGGTGG
AAAACAAAAAGTCTGTTGGATGGAAGAACACATCCCAAAGAAGTGAACATTCTAAGATTT
TCAGGACAAAGAAACTCTGGAATGGTTCCTTCCTTAGATGCCTTTAGTGAATTTCATTTA
ACAGTCTTAGCCTATAACTCTAAAGGAGCTGGTCCTGAAAGTGAGCCTTATATATTTCAA
ACACCAGAAGGAGTACCTGAACAGCCAACTTTTCTAAAGGTCATCAAAGTTGATAAAGAC
ACTGCCACTTTATCTTGGGGACTACCTAAGAAATTAAATGGAAACTTAACTGGCTATCTT
TTGCAATATCAGATAATAAATGACACCTACGAGATTGGAGAATTAAATGATATTAACATT
ACAACTCCATCAAAGCCCAGCTGGCACCTCTCAAACCTGAATGCAACTACCAAGTACAAA
TTCTACTTGAGGGCTTGCACTTCACAGGGCTGTGGAAAACCGATCACGGAGGAAAGCTCC
ACCTTAGGAGAAGGGAGTAAAGGTATCGGGAAGATATCAGGAGTAAATCTTACTCAAAAG
ACTCACCCAATAGAGGTATTTGAGCCGGGAGCTGAACATATAGTTCGCCTAATGACTAAG
AATTGGGGCGATAATGATAGCATTTTTCAAGATGTAATTGAGACAAGAGGGAGAGAATAT
GCTGGTTTATATGATGACATCTCCACTCAAGGCTGGTTTATTGGACTGATGTGTGCGATT
GCTCTTCTCACACTACTATTATTAACTGTTTGCTTTGTGAAGAGGAATAGAGGTGGAAAG
TACTCAGTTAAAGAAAAGGAAGATTTGCATCCAGACCCAGAAATTCAGTCAGTAAAAGAT
GAAACCTTTGGTGAATACAGTGACAGTGATGAAAAGCCTCTCAAAGGAAGCCTTCGGTCC
CTTAATAGGGATATGCAGCCTACTGAAAGTGCTGACAGCTTAGTCGAATACGGAGAGGGA
GACCATGGTCTCTTCAGTGAAGATGGATCATTTATTGGTGCCTACGCTGGATCTAAGGAG
AAGGGATCTGTTGAAAGCAATGGAAGTTCTACAGCAACTTTTCCCCTTCGGGCATAAACA
CAACATATGTAAGCAACGCTACTGGTTCACCCCAACCTTCCATATTTATCTGTTCAAAGG
AGCAAGAACTTTCATATAGGAATAGAAACATGCTGGCCGAAGATTTCATCCAGAAGTCAA
CATCCTGCAATTATGTTGAAAAGAGTAGTACTTTCTTCAAAATATAAAATGCCAAGCACT
TCAGGCCTATGTTTTGCTTATATTGTTTTCAGGTGCTCAAAATGCAAAACACAAAACAAA
TCCTGCATTTAGATACACCTCAACTAAATCCAAAGTCCCCATTCAGTATATTCCATATTT
GCCTGATTTTACTATTCGGTGTGTTTGCATAGATGTTGCTACTTGGTGGGTTTTTCTCCG
TATGCACATTGGTATACAGTCTCTGAGAACTGGCTTGGTGACTTTGCTTCACTACAGGTT
AAAAGACCATAAGCAAACTGGTTATTTAAAATGTAAAAAGGAATATGAAAGTCTTATTAA
AACACTTCATTGAAAATATACAGTCTAAATTTATTATTTAAATTTTACTAGCAAAAGTCT
TAGGTGAACAATCAACTAGTATTTGTTGAGCTCCTATTTGCCCAGAGATGGTCATATTTA
AACAGAAGTATACGTTTTTCAGTTTCAACATGAATTTTTTTATTTCTGTCAGTTATGACA
TCCACAAGCATCACTTTTTGTGTCTGTTTTTTTTTTTTTTCTTGGACTAAATTCAACTGC
ATGGAAGCGGTGGTCAGAAGGTTGTTTTATACGAGAACAGGCAGAAAGTGCCCATTGTTC
AGGATTCTAATAGCTACATCTACTTAATATCTTCATTTCTAAATTGACTGCTTTTACCTT
TTTCTCATGTTTATATAATGGTATGCTTGCATATATTTCATGAATACATTGTACATATTA
TGTTAATATTTACACAATTTAAAATATAGATGTGTTTTATTTTGAAGTGAGAAAATGAAC
ATTAACAGGCATGTTTGTACAGCTAGAATATATTAGTAAGATACTGTTTTTCGTCATTCC
AGAGCTACAACTAATAACACGAGGTTCCAAAGCTGAAGACTTTGTATAAAGTATTTGGGT
TTTGTTCTTGTATTGCTTTCTTTCAACAGTTTCAAAATAAAATATCATATAAATATTGAG
GGAAATGTTTTCATATTTTTCAAAATAGGTTTTTATTGTTGAATGTACATCTACCCCAGC
CCCTCAAAAGAAAAACTGTTTACATAGAAATTCCTACACATACGTTTGCGTATATGTTAT
TTTAAACATCTTTGTGGTGAGAATTTTTTCCCCGATATTCTCCTTCTGTCAAAGTCAGAA
CAAATTCAGGGAATTTATTTTCTGGCAGTTGTGCTCCAGTCCTTTTAAAATTGTACATGA
ACATGTTTTAGAAACAATATGGAGGATGATGCATACATGTCGGTCAAGTTCAGCGCTCGA
CATTTTATGGAAAGATTTTTTTAACCTTACCACGAAATACTTAACTACTGTTTAAGTGAA
TTGACTTATTTCACTTTAGTTTTTGAACTGTGATTATTGGTATACTGTTATATCCTCAAC
TTGGATTTATGGTAACCCCTTATAGTTCATGGAGACCAAAATTTGGGGTATTTATAATAG
TCAGCGCAGGAATGCACATGGAATATCTACTTGTCCTTTTGAACCTCACGAGTCATCCAG
AATGTATAGACAGGAAAAGCATGTCTTATTTAAAACTGTAATTTATGGGCTCAGGATCTG
ACCGCAGTCCCGGGAGTAAGCATTTCAAAGGGGGAAGGCAGTGTGGTCCCTACCCTGTGT
GAATGTGAGGATGTAGACATCCATCAGTGCAACTCGAGCTCCATCCTCCTCCGATTTCTA
AGGTTCCAGTTTTCTGGAGGGACAGTCATCATGTTTTGATTTATCTGGGAGAAAACTGTG
GTGCACAGCTTGTGAGGAGGGCAAGGTTGTGACGTTCGAGCTTAGTTCTGGTGTTATTCT
GTCTCCTCTTCTTTGTCATCAGCCAAAACGTGGTTTTTAAAGAGAGTCATGCAGGTTAGA
AATAATGTCAAAAATATTTAGGAATTTAATAACCTTTAAGTCAGAAACTAAAACAAATAC
TGAAATATTAGCTCTTCCTACACTTCGTGTTCCCCTTTAGCTGCCTGAAAATCAAGATTG
CTCCTGCTCAGATCTTCTGAGTGGCTAAAACTTATGGATATGAAAAATGAGATTGAATGA
TGACTATGCTTTGCTATCATTGTTACCTTTCCTCAATACTATTTGGCAACTACTGGGACT
CTTCAGCACAAAAGGAATAGATCTATGATTGACCCTGATTTTAATTGTGAAATTATATGA
TTCATATATTTTATGAATCAGAATAACCTTCAAATAAAATAAATCTAAGTCGGTTAAAAT
GGATTTCATGATTTTCCCTCAGAAAATGAGTAACAGAGTCCACGGCGTGCAATGGTAATT
ATAAATTGGTGATGCTTGTTTGCAAATTGCCCACTCGTGATAAGTCAACAGCCAATATTT
AAAACTTTGTTCGTTACTGGCTTTACCCTAACTTTCTCTAGTCTACTGTCAATATCATTT
TAATGTAATTGATTGTATATAGTCTCAAGAATGGTTGGTGGGCATGAGTTCCTAGAGAAC
TGTCCAAGGGTTGGGAAAATCCAAATTCTCTTCCTGGTTCCAGCACTGATTTTGTACATA
AACATTAGGCAGGTTGCTTAACCTTTTTATTTCAAACTCTCTCAACTCTAAAGTGCTAAT
AATAATCTCAGTTACCTTATCTTTGTCACAGGGTGTTCTTTTTTATGAAGAAAAATTTGA
AAATGATAAAAGCTAAGATGCCTTCTAACTTCATAAGCAAACCTTTAACTAATTATGTAT
CTGAAAGTCACCCCCACATACCAACTCAACTTTTTTCCTGTGAACACATAAATATATTTT
TATAGAAAAACAAATCTACATAAAATAAATCTACTGTTTAGTGAGCAGTATGATTTGTAC
ATGCCATTGAAAATTATTAATCAGAAGAAAATTAAGCAGGGTCTTTGCTATACAAAAGTG
TTTTCCACTAATTTTGCATGCGTATTTATAAGAAAAATGTGAATTTGGTGGTTTTATTCT
ATCGGTATAAAGGCATTGATATTTTAGATGCACCCGTGTTTGTAAAAATGTAGAGCACAA
TGGAATTATGCTGGAAGTCTCAAATAATATTTTTTTCCTATTTTATACTCATGGAAGAGA
TAAGCTAAAGAGGGGACAATAATGAGAAATGTTGGTGTGCTTTTCTAAGCATTTAAAACA
TAATTGCCAATTGAAACCCTAAATATGTTTACATACCATTAAGATATGATTCATGTAACA
ATGTTAAATTAATTATAATGGGATTGGGTTTGTTATCTGTGGTAGTATATATCCTAGTGT
TCCTATAGTGAAATAAGTAGGGTTCAGCCAAAGCTTTCTTTGTTTTGTACCTTAAATTGT
TCGATTACGTCATCAAAAGAGATGAAAGGTATGTAGAACAGGTTCACGTGATTACCTTTT
TCTTTTGGCTTGGATTAATATTCATAGTAGAACTTTATAAAACGTGTTTGTATTGTAGGT
GGTGTTTGTATTATGCTTATGACTATGTATGGTTTGAAAATATTTTCATTATACATGAAA
TTCAACTTTCCAAATAAAAGTTCTACTTCATGTAATCCAAAAAAAAAAAAA

Protein Sequence

>10752 : length: 1224
MEPLLLGRGLIVYLMFLLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAK
GNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMS
EEIEFIVPSVPKFPKEKIDPLEVEEGDPIVLPCNPPKGLPPLHIYWMNIELEHIEQDERV
YMSQKGDLYFANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVNSLKHANDSSSSTEIG
SKANSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVDWNKIGGDLPKG
RETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYST
GSNGILLCEAEGEPQPTIKWRVNGSPVDNHPFAGDVVFPREISFTNLQPNHTAVYQCEAS
NVHGTILANANIDVVDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEVK
PLEGRRYHIYENGTLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSPKNP
RIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLE
DQGIYCCSAHTALDSAADITQVTVLDVPDPPENLHLSERQNRSVRLTWEAGADHNSNISE
YIVEFEGNKEEPGRWEELTRVQGKKTTVILPLAPFVRYQFRVIAVNEVGRSQPSQPSDHH
ETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVTWKPQGAPVEWEEET
VTNHTLRVMTPAVYAPYDVKVQAINQLGSGPDPQSVTLYSGEDYPDTAPVIHGVDVINST
LVKVTWSTVPKDRVHGRLKGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLDA
FSEFHLTVLAYNSKGAGPESEPYIFQTPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNG
NLTGYLLQYQIINDTYEIGELNDINITTPSKPSWHLSNLNATTKYKFYLRACTSQGCGKP
ITEESSTLGEGSKGIGKISGVNLTQKTHPIEVFEPGAEHIVRLMTKNWGDNDSIFQDVIE
TRGREYAGLYDDISTQGWFIGLMCAIALLTLLLLTVCFVKRNRGGKYSVKEKEDLHPDPE
IQSVKDETFGEYSDSDEKPLKGSLRSLNRDMQPTESADSLVEYGEGDHGLFSEDGSFIGA
YAGSKEKGSVESNGSSTATFPLRA