ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10744

Name

PTTG2

Synonym

pituitary tumor-transforming 2;PTTG2;pituitary tumor-transforming 2

Definition

pituitary tumor-transforming gene 2 protein|securin-2

Position

4p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

External Links

Links to cell senescence gene database

10744

Links to epithelial mesenchymal transition gene database

10744

Links to ovarian cancer gene database

10744

Links to endometrial cancer gene database

10744

Links to iHOP

10744

Sequence Information

Nucleotide Sequence

>10744 : length: 576
ATGGCTACTCTGATCTACGTTGATAAGGAAATTGGAGAACCAGGCACCCGTGTGGCTGCC
AAGGATGTGCTGAAGCTGGAGTCTAGACCTTCAATCAAAGCATTAGATGGGATATCTCAA
GTTTTAACACGACGTTTTGGCAAAACATACGATGCTCCATCAGCCTTACCTAAAGCTACC
AGAAAGGCTTTGGGCACTGTCAACAGAGCTACAGAAAAGTCAGTAAAGACCAATGGACCC
AGAAAACAAAAACAGCCAAGCTTTTCTGCCAAAAAGATGACCGAGAAGACTGTTAAAACA
AAAAGTTCTGTTCCTGCCTCAGATGACGCCTATCCAGAAATAGAAAAATTCTTTCCCTTC
AATCTTCTAGACTTTGAGAGTTTTGACCTGCCTGAAGAGCGCCAGATTGCACACCTCCCC
TTGAGTGGAGTGCCTCTCATGATCCTTGATGAGGAGGGAGAGCTTGAAAAGCTGTTTCAG
CTGGGCCCCCCTTCACCTGTGAAAATGCCCTCTCCACCATGGGAATGCAATCTGTTTGCA
GTCTCCTTCAAGCATTCTGTCGACCCTGGATGTTGA

Protein Sequence

>10744 : length: 191
MATLIYVDKEIGEPGTRVAAKDVLKLESRPSIKALDGISQVLTRRFGKTYDAPSALPKAT
RKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKTKSSVPASDDAYPEIEKFFPF
NLLDFESFDLPEERQIAHLPLSGVPLMILDEEGELEKLFQLGPPSPVKMPSPPWECNLFA
VSFKHSVDPGC