ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10712

Name

FAM189B

Synonym

C1orf2|COTE1;family with sequence similarity 189, member B;FAM189B;family with sequence similarity 189, member B

Definition

protein FAM189B

Position

1q21

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10712

Links to epithelial mesenchymal transition gene database

10712

Links to ovarian cancer gene database

10712

Links to endometrial cancer gene database

10712

Links to iHOP

10712

Sequence Information

Nucleotide Sequence

>10712 : length: 3209
ATTCCCATCCCCCTTCTCTAGTCCCCGACCTGCGGCAGCCGGAGCTCGGGGAGCGGAGCG
TGGTGGGGAGGGGAGCGGGACAGGCGACACAGGAGACAGCGGCGCCGCGGCCTCTCCCCA
CCAGGCGGCCCCGGATCCTACTGGACGCCCTGAGGGCACACCGACCGCGCCTCTAGAGTC
ACCCCACGCCGACCCCTCCCCTCTTCTCTAGACTTATTTCCATCCTTCCCGCTTTTACCC
TCCCCACCCCTCCCTGGGCTCCAGGCCGCCGCCCCCTCCTCACTCCTGGACCGGCCCTTC
TCGGTGCCCCTCTTCCCTAGGGAGATGCGATGAGCCGGTGCCCCCGCGTCCTCATCGTCG
CCCCGGGCACGGTGCCCGTCCAGTGCCCGTGGTGGGGAGGGAGCACTCCGCGGTCCCTCC
GTGACGCCCCTCGCTTGGCCCCCCCCACAGCTGGCGTCCCTCGGCCATGCCCCAGGGGAC
CCAGCCAGGGGGTGGGCTCTAGAGCGAGTGGGGTGGAGAGGAGAAAGGACGGGGCCTTGG
GCGCCTCTGAGATGCTCCCAAGTGCCAGGGAGGGCCGAGCGAGGCGCAGGCAACCGGGCA
GCAGGCATGATGCCCTCGCCTAGTGACTCCAGCCGCTCGCTGACCAGCCGGCCCAGCACC
AGGGGCCTTACCCACCTCCGCCTCCACCGACCCTGGCTGCAGGCCCTGCTTACGCTGGGG
CTGGTCCAAGTGCTCCTGGGCATCCTGGTGGTCACCTTCAGCATGGTGGCCTCTTCCGTC
ACCACCACCGAGAGCATCAAGAGGTCCTGCCCGTCTTGGGCTGGGTTCTCGCTGGCGTTC
TCCGGGGTGGTTGGCATTGTGTCCTGGAAGCGGCCATTCACTCTAGTGATCTCCTTCTTC
TCCTTGCTTTCGGTGCTCTGTGTCATGCTTAGCATGGCTGGCTCTGTTCTCTCCTGTAAG
AATGCTCAACTGGCCCGAGACTTCCAACAGTGCTCTCTGGAAGGAAAGGTCTGTGTGTGC
TGTCCCTCTGTTCCCCTCCTCCGGCCCTGTCCAGAGTCGGGGCAGGAACTGAAAGTTGCC
CCTAACTCCACCTGTGATGAAGCCCGAGGGGCCCTCAAGAACCTGCTCTTCAGCGTCTGT
GGGCTCACCATTTGTGCCGCTATAATCTGTACACTCTCTGCTATTGTCTGCTGCATCCAA
ATCTTCTCCCTGGACCTCGTGCATACGCTGGCCCCTGAGCGGTCAGTCTCAGGCCCACTG
GGACCTCTGGGCTGCACGTCCCCGCCCCCAGCCCCTCTCCTACACACCATGCTGGACCTG
GAGGAATTTGTCCCGCCTGTGCCCCCACCGCCCTACTATCCCCCAGAGTATACCTGCAGC
TCAGAAACAGATGCACAGAGCATCACGTACAATGGCTCCATGGACAGCCCAGTGCCCTTG
TACCCTACCGATTGCCCCCCTTCTTATGAGGCAGTCATGGGACTACGAGGAGACAGCCAG
GCCACTCTCTTTGACCCTCAGCTTCACGATGGCTCGTGCATCTGTGAACGAGTGGCCTCC
ATTGTAGACGTGTCCATGGACAGCGGGTCTCTGGTGCTGTCAGCCATTGGTGACCTCCCT
GGGGGCTCTAGCCCGTCGGAGGACTCGTGCCTGCTGGAGCTGCAGGGCTCCGTGCGCTCC
GTGGACTACGTTCTCTTTCGCTCCATCCAGCGCAGCCGTGCCGGCTACTGCCTCAGCCTG
GACTGTGGCCTGCGGGGCCCCTTCGAGGAAAGCCCCCTGCCACGGCGCCCCCCACGGGCT
GCCCGCTCCTATTCCTGCTCTGCCCCTGAAGCTCCACCCCCACTGGGTGCCCCCACAGCT
GCCCGCAGCTGCCACCGGTTGGAGGGCTGGCCGCCCTGGGTGGGACCCTGCTTCCCCGAG
CTGAGGCGGCGGGTCCCCCGGGGAGGGGGCCGCCCAGCCGCAGCCCCGCCCACCCGAGCC
CCGACTCGTCGCTTCAGCGATAGCTCAGGTTCCCTCACCCCACCGGGGCACCGGCCTCCT
CATCCGGCATCCCCACCACCGCTGCTGCTGCCACGGTCCCACAGCGACCCAGGCATCACG
ACCTCCAGTGACACTGCTGACTTCAGGGACCTTTATACCAAAGTGCTTGAGGAAGAAGCT
GCTTCTGTTTCCTCTGCAGATACAGGGCTCTGCTCTGAAGCCTGCCTCTTCCGCCTAGCC
CGCTGCCCTTCCCCCAAGTTGCTACGTGCCCGGTCAGCCGAGAAACGGCGCCCTGTGCCC
ACCTTCCAAAAAGTTCCCCTGCCCTCGGGCCCTGCACCTGCCCACTCCCTGGGGGACCTA
AAGGGCAGCTGGCCAGGTCGGGGCCTGGTCACTCGTTTCCTCCAGATATCCAGGAAAGCC
CCAGACCCCAGTGGGACTGGAGCTCATGGACATAAGCAGGTGCCCCGGAGCCTGTGGGGC
CGGCCTGGCCGAGAGAGCCTCCACCTTCGCAGCTGCGGAGATCTGAGCTCTAGCTCTTCC
CTGCGGCGTCTCCTGTCTGGCCGCAGGCTGGAGCGTGGTACCCGCCCCCACAGCCTCAGC
CTCAACGGGGGCAGCCGGGAGACTGGGCTCTGACCTAGGCTTCTTGTCACACTGAACACA
TCCAGCCACAGGCACCAGCTGGTTGGGACCAGCAGCCCCCAGCATCCTCTTGCACTGGCT
GGCACAAAAAGAAACCTGCTGTATACCCCCCAAAGTGTCCCTTTCCCTCCTACCTCTGGG
GTCTCTTGCTGCTTGCCTCTGCTGCTCTGGACTGGGAGAGCTTCTGTCCTGTGCTGCATG
GGTATTTAGACTGTGGGGGAGATGCCCCTTCTTATAGCACTGGAGGAGGAAAACAAATTC
TTGTCCCCCTCAGAATGAGAGTGGCTCTTTCTGATTTGCAAGGGCACTATGGTCAGGGCA
AAGGCATGGCCCAGGTGTTTAAGTACAGGGTGACGTGTGCCTATGCAATGGGGTGGTAAG
GCAGGCACGAAGAGTCCAAAAAATCTAGGTGGCCTCTCAGCTCTGCCACCTCTAGCTGCA
TGACCTTGGGCAAGCTATGTAACCCCAATTGCCTGCTCCATTAAAGACTGTGAAGGTAGA
ATGTTTGTAAAGCTCTTAACAGTATGTAAGCCTTCAATAAATTTCAGTTTTCCCCTTGTT
TTCTTGATCAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>10712 : length: 669
MMPSPSDSSRSLTSRPSTRGLTHLRLHRPWLQALLTLGLVQVLLGILVVTFSMVASSVTT
TESIKRSCPSWAGFSLAFSGVVGIVSWKRPFTLVISFFSLLSVLCVMLSMAGSVLSCKNA
QLARDFQQCSLEGKVCVCCPSVPLLRPCPESGQELKVAPNSTCDEARGALKNLLFSVCGL
TICAAIICTLSAIVCCIQIFSLDLVHTQLAPERSVSGPLGPLGCTSPPPAPLLHTMLDLE
EFVPPVPPPPYYPPEYTCSSETDAQSITYNGSMDSPVPLYPTDCPPSYEAVMGLRGDSQA
TLFDPQLHDGSCICERVASIVDVSMDSGSLVLSAIGDLPGGSSPSEDSCLLELQGSVRSV
DYVLFRSIQRSRAGYCLSLDCGLRGPFEESPLPRRPPRAARSYSCSAPEAPPPLGAPTAA
RSCHRLEGWPPWVGPCFPELRRRVPRGGGRPAAAPPTRAPTRRFSDSSGSLTPPGHRPPH
PASPPPLLLPRSHSDPGITTSSDTADFRDLYTKVLEEEAASVSSADTGLCSEACLFRLAR
CPSPKLLRARSAEKRRPVPTFQKVPLPSGPAPAHSLGDLKGSWPGRGLVTRFLQISRKAP
DPSGTGAHGHKQVPRSLWGRPGRESLHLRSCGDLSSSSSLRRLLSGRRLERGTRPHSLSL
NGGSRETGL